8GDW: Domain Related to Iron (DRI) from cyanobacteria

Crystal structure of Domain Related to Iron (DRI) from cyanobacteria. Determined by X-ray diffraction at 2.35 Å resolution. Released 13 Mar 2024.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Synechocystis sp. PCC 6803
Chains: 4
Atoms: 3,134
Mol. weight: 45.49 kDa
Ligands: ZN
Released: 13 Mar 2024

Explore 8GDW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GDW contains 16 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
α-helix	22-30	9
β-strand	38-47	10	1
β-strand	50-57	8	1
β-strand	61-67	7	1
α-helix	75-77	3
α-helix	78-90	13
α-helix	95-98	4

Chain BBB: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
α-helix	22-31	10
β-strand	38-47	10	2
β-strand	50-57	8	2
β-strand	60-67	8	2
α-helix	75-97	23

Chain CCC: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
α-helix	22-31	10
β-strand	38-47	10	3
β-strand	50-57	8	3
β-strand	61-67	7	3
α-helix	79-91	13
α-helix	94-97	4
β-strand	100-102	3	1

Chain DDD: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
α-helix	22-31	10
β-strand	40-47	8	4
β-strand	50-58	9	4
β-strand	60-67	8	4
α-helix	75-77	3
α-helix	78-90	13
β-strand	100-102	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ssr1698 protein	AAA, BBB, CCC, DDD	protein	103	Synechocystis sp. PCC 6803	P73129 (AlphaFold model)

Sequence of entity 1 (AAA, BBB, CCC, DDD), FASTA

>8GDW_1 Ssr1698 protein (chains AAA, BBB, CCC, DDD)
MADPLTPAISDRICKHMNEDHASAIALYAQVFGQQTDVTMAQMQAIDPTGMDLVVESEGG
SKTIRIEFEQPLKDSEDAHQVLIAMAKQARSVGKNSAENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

A hemoprotein with a zinc-mirror heme site ties heme availability to carbon metabolism in cyanobacteria. Grosjean, N., Yee, E.F., Kumaran, D. et al. Nat Commun (2024) 15:3167-3167. DOI 10.1038/s41467-024-47486-z · PubMed

Other PDB entries of the same protein (UniProt P73129 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZXQ 1.51 Å, Crystal structure of Ssr1698 in complex with heme b
8ZXR 1.6 Å, Crystal structure of Ssr1698 in complex with heme c
8FM6 2.85 Å, Dri1 hemoprotein variant H21A with a zinc-mirror heme site
8GBK 2.9 Å, Dri1 hemoprotein variant H79A-R90A with a zinc-mirror heme site
8GF4 3.0 Å, Crystal structure of Domain Related to Iron (DRI) in complex with heme

Browse structure collections

About this viewer

MolViewer shows 8GDW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.