8ZXR: Ssr1698

Crystal structure of Ssr1698 in complex with heme c. Determined by X-ray diffraction at 1.6 Å resolution. Released 25 Dec 2024.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Synechocystis sp. (strain PCC 6803 / Kazusa), Equus caballus
Chains: 2
Atoms: 1,002
Mol. weight: 13.73 kDa
Ligands: HEC, NI
Released: 25 Dec 2024

Explore 8ZXR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZXR contains 5 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
α-helix	7-20	14
α-helix	22-31	10
β-strand	40-47	8	1
β-strand	50-57	8	1
β-strand	60-67	8	1
α-helix	75-93	19

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	15-18	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ssr1698 protein	A	protein	105	Synechocystis sp. (strain PCC 6803 / Kazusa)	P73129 (AlphaFold model)
Cytochrome c	B	protein	11	Equus caballus	P00004 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8ZXR_1 Ssr1698 protein (chains A)
MMADPLTPAISDRICKHMNEDHASAIALYAQVFGQQTDVTMAQMQAIDPTGMDLVVESEG
GSKTIRIEFEQPLKDSEDAHQVLIAMAKQARSVGKNSLEHHHHHH

Sequence of entity 2 (B), FASTA

>8ZXR_2 Cytochrome c (chains B)
VQKCAQCHTVQ

Ligands and cofactors

ID	Name	Formula	Copies
HEC	Heme C	C34 H36 Fe N4 O4	1
NI	Nickel (II) ion	Ni	1

Water and common crystallization additives (GOL, CL) are not listed.

Primary citation

Structural Basis for Monomer-Dimer Transition of Dri1 Upon Heme Binding. Wang, X.Y., Zhang, J., Li, H.Y. et al. Proteins (2025) 93:949-956. DOI 10.1002/prot.26778 · PubMed

Other PDB entries of the same protein (UniProt P73129 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZXQ 1.51 Å, Crystal structure of Ssr1698 in complex with heme b
8GDW 2.35 Å, Crystal structure of Domain Related to Iron (DRI) from cyanobacteria
8FM6 2.85 Å, Dri1 hemoprotein variant H21A with a zinc-mirror heme site
8GBK 2.9 Å, Dri1 hemoprotein variant H79A-R90A with a zinc-mirror heme site
8GF4 3.0 Å, Crystal structure of Domain Related to Iron (DRI) in complex with heme

Browse structure collections

About this viewer

MolViewer shows 8ZXR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.