8GQE: W285A mutant of UVR8

Crystal structure of the W285A mutant of UVR8 in complex with RUP2. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Sept 2022.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Arabidopsis thaliana
Chains: 2
Atoms: 6,064
Mol. weight: 87.7 kDa
Released: 14 Sept 2022

Explore 8GQE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GQE contains 19 α-helices and 59 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	24-33	10	1
β-strand	43-48	6	2
β-strand	54-59	6	2
β-strand	63-68	6	2
α-helix	69-75	7
α-helix	82-83	2
β-strand	84-87	4	1
α-helix	88-91	4
β-strand	94-97	4	2
β-strand	102-107	6	3
α-helix	108	1
β-strand	115-120	6	3
β-strand	125-129	5	3
β-strand	134-139	6	3
α-helix	145-146	2
β-strand	147-152	6	4
α-helix	157-159	3
β-strand	162-166	5	4
β-strand	171-174	4	4
β-strand	185-187	3	4
β-strand	197-202	6	5
β-strand	209-214	6	5
β-strand	219-223	5	5
α-helix	230-231	2
β-strand	232-234	3	5
β-strand	241-248	8	6
β-strand	251-256	6	6
β-strand	260-265	6	6
β-strand	271-276	6	6
β-strand	283	1	7
β-strand	287-290	4	8
β-strand	295-298	4	8
β-strand	305-309	5	8
β-strand	317-319	3	8
β-strand	335-340	6	1
β-strand	347-354	8	1
β-strand	359-366	8	1

Chain B: 12 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
β-strand	17-22	6	9
β-strand	26-31	6	9
β-strand	35-40	6	9
β-strand	55-60	6	9
α-helix	62-64	3
β-strand	71-74	4	10
β-strand	78-83	6	10
β-strand	88-93	6	10
α-helix	96-98	3
β-strand	108-113	6	10
α-helix	115-117	3
β-strand	122-127	6	11
β-strand	131-136	6	11
β-strand	141-145	5	11
β-strand	160-165	6	11
α-helix	167-169	3
β-strand	174-179	6	12
β-strand	183-188	6	12
β-strand	193-197	5	12
β-strand	212-217	6	12
β-strand	226-231	6	13
β-strand	235-240	6	13
β-strand	245-249	5	13
β-strand	264-269	6	13
α-helix	271-273	3
β-strand	278-283	6	14
β-strand	287-292	6	14
β-strand	297-301	5	14
β-strand	316-322	7	14
α-helix	323	1
α-helix	325-327	3
α-helix	328-329	2
β-strand	330-335	6	15
β-strand	339-344	6	15
β-strand	349-353	5	15
β-strand	368-373	6	15
α-helix	375-377	3
α-helix	403-405	3
β-strand	409	1	7
α-helix	410-411	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WD repeat-containing protein RUP2	A	protein	369	Arabidopsis thaliana	Q9FFA7 (AlphaFold model)
Ultraviolet-B receptor UVR8	B	protein	443	Arabidopsis thaliana	Q9FN03 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8GQE_1 WD repeat-containing protein RUP2 (chains A)
MARYEWDLSLSTVVSSSSSSASDVIGAIEFDPTDNIVATAGISRKIRFYGLPSLLRNNAV
SGTGVSFVDQATACEYYICTPAKLSSLRWRPGSGGRVIGSGDYDGVVMEYDLEKRTPVFE
RDEHGGRRVWSVDYTRHGGASTVGASGSDDGTMQVWDPRCPPEESVGVVRPAGICRSAVC
CVEFDPSGGPAVAVGCADRKGYVYDIRKLVDPALTLQGHTKTVSYVRFLDGGTVVTAGTD
GCLKLWSVEDGRVIRTYEGHVNNRNFVGLSVWRNGALFGCGSENNRVFVYDRRWGKPVWV
DGFEPVGMNSGSDKRFVSSVCWRQSGVDQCTLVAGGSDGVLQVYVGKRLEDYKDHDGDYK
DHDIDYKDD

Sequence of entity 2 (B), FASTA

>8GQE_2 Ultraviolet-B receptor UVR8 (chains B)
MAPPRKVLIISAGASHSVALLSGDIVCSWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIV
SVTCGADHTVAYSQSGMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDS
HCLAVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTED
GDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGALYTYGW
SKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGARHTMALTSDGKLYGWGWNKFGQVGV
GNNLDQCSPVQVRFPDDQKVVQVSCGWRHTLAVTERNNVFAWGRGTNGQLGIGESVDRNF
PKIIEALSVDGASGQHIESSNIDPSSGKSWVSPAERYAVVPDETGLTDGSSLESAWSHPQ
FEKGGGSGGGSGGSAWSHPQFEK

Primary citation

RUP2 facilitates UVR8 redimerization via two interfaces. Wang, L., Wang, Y., Chang, H. et al. Plant Commun (2023) 4:100428-100428. DOI 10.1016/j.xplc.2022.100428 · PubMed

Browse structure collections

About this viewer

MolViewer shows 8GQE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.