8GR8: Citrate synthase

Crystal structure of peroxisomal citrate synthase (Cit2) from Saccharomycescerevisiae. Determined by X-ray diffraction at 2.39 Å resolution. Released 26 Apr 2023.

Method: X-ray diffraction
Resolution: 2.39 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 7,206
Mol. weight: 104.03 kDa
Released: 26 Apr 2023

Explore 8GR8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GR8 contains 58 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	26-48	23
β-strand	52-57	6	1
α-helix	58-61	4
β-strand	69-72	4	2
β-strand	76-79	4	3
β-strand	83-86	4	3
β-strand	89	1	3
α-helix	91-97	7
β-strand	100	1	4
β-strand	107	1	4
α-helix	108	1
α-helix	109-118	10
α-helix	121-123	3
α-helix	124-136	13
α-helix	139-141	3
α-helix	142-150	9
α-helix	157-167	11
α-helix	168-171	4
α-helix	173-179	7
α-helix	184-186	3
α-helix	187-214	28
α-helix	219-221	3
α-helix	228-236	9
α-helix	241-253	13
α-helix	262-272	11
α-helix	277-288	12
α-helix	296-311	16
α-helix	317-329	13
β-strand	337	1	5
α-helix	347-359	13
α-helix	364-383	20
β-strand	391	1	5
α-helix	393-395	3
α-helix	397-403	7
α-helix	409-411	3
α-helix	412-434	23
α-helix	436-438	3
β-strand	442-444	3	6
α-helix	446-457	12

Chain B: 29 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	23-25	3
α-helix	26-48	23
β-strand	52-57	6	1
α-helix	58-61	4
β-strand	69-72	4	6
β-strand	76-79	4	7
β-strand	83-86	4	7
β-strand	89	1	7
α-helix	91-97	7
β-strand	100	1	8
β-strand	107	1	8
α-helix	108	1
α-helix	109-118	10
α-helix	121-123	3
α-helix	124-136	13
α-helix	139-141	3
α-helix	142-150	9
α-helix	157-167	11
α-helix	168-171	4
α-helix	173-180	8
α-helix	184-186	3
α-helix	187-214	28
α-helix	228-236	9
α-helix	241-253	13
α-helix	262-271	10
α-helix	277-288	12
α-helix	296-311	16
α-helix	317-329	13
β-strand	337-339	3	9
α-helix	347-357	11
α-helix	364-383	20
β-strand	388-391	4	9
α-helix	393-395	3
α-helix	397-403	7
α-helix	409-411	3
α-helix	412-433	22
α-helix	436-439	4
β-strand	442-444	3	2
α-helix	446-458	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Citrate synthase	A, B	protein	460	Saccharomyces cerevisiae	P08679 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8GR8_1 Citrate synthase (chains A, B)
MTVPYLNSNRNVASYLQSNSSQEKTLKERFSEIYPIHAQDVRQFVKEHGKTKISDVLLEQ
VYGGMRGIPGSVWEGSVLDPEDGIRFRGRTIADIQKDLPKAKGSSQPLPEALFWLLLTGE
VPTQAQVENLSADLMSRSELPSHVVQLLDNLPKDLHPMAQFSIAVTALESESKFAKAYAQ
GISKQDYWSYTFEDSLDLLGKLPVIAAKIYRNVFKDGKMGEVDPNADYAKNLVNLIGSKD
EDFVDLMRLYLTIHSDHEGGNVSAHTSHLVGSALSSPYLSLASGLNGLAGPLHGRANQEV
LEWLFALKEEVNDDYSKDTIEKYLWDTLNSGRVIPGYGHAVLRKTDPRYMAQRKFAMDHF
PDYELFKLVSSIYEVAPGVLTEHGKTKNPWPNVDAHSGVLLQYYGLKESSFYTVLFGVSR
AFGILAQLITDRAIGASIERPKSYSTEKYKELVKNIESKL

Primary citation

Defective import of mitochondrial metabolic enzyme elicits ectopic metabolic stress. Nishio, K., Kawarasaki, T., Sugiura, Y. et al. Sci Adv (2023) 9:eadf1956-eadf1956. DOI 10.1126/sciadv.adf1956 · PubMed

Other PDB entries of the same protein (UniProt P08679 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GR9 1.48 Å, Crystal structure of peroxisomal citrate synthase (Cit2) from Saccharomyces cerevisiae…
8GRE 2.3 Å, F-box protein in complex with skp1(FL) and substrate
8GRF 2.53 Å, Crystal structure of F-box protein in the ternary complex with adaptor protein Skp1(DL)…

Browse structure collections

About this viewer

MolViewer shows 8GR8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.