8GW3: Human TAK1 kinase domain fused with TAB1

Crystal structure of human TAK1 kinase domain fused with TAB1. Determined by X-ray diffraction at 2.05 Å resolution. Released 20 Sept 2023.

Method

X-ray diffraction

Resolution

2.05 Å

Organism

Homo sapiens

Chains

4

Atoms

9,458

Mol. weight

146.96 kDa

Released

20 Sept 2023

Explore 8GW3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GW3 contains 80 α-helices and 56 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 14 β-strands

Molecules and chains

>8GW3_1 Mitogen-activated protein kinase kinase kinase 7, TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 (chains A, B, C, D)
AGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAF
IVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWC
LQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAA
WMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKN
LPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRV
EPYVDFAEFYRLWSVDHGEQSVVTAP

Primary citation

Crystal structure of human TAK1 kinase domain fused with TAB1. Liu, J., Sun, W., Gao, J. To be published.

Related structures

Other PDB entries of the same protein (UniProt O43318 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 7NTH 1.97 Å, Structure of TAK1 in complex with compound 54
• 7NTI 1.98 Å, Structure of TAK1 in complex with compound 22
• 2EVA 2.0 Å, Structural Basis for the Interaction of TAK1 Kinase with its Activating Protein TAB1
• 5JGA 2.0 Å, Crystal structure of human TAK1/TAB1 fusion protein in complex with ligand 11c
• 5V5N 2.01 Å, Crystal structure of Takinib bound to TAK1
• 5E7R 2.11 Å, Crystal structure of TL10-81 bound to TAK1-TAB1
• 4GS6 2.2 Å, Irreversible Inhibition of TAK1 Kinase by 5Z-7-Oxozeaenol
• 5JH6 2.37 Å, Crystal structure of TL10-92 bound to TAK1-TAB1
• 5J7S 2.37 Å, Crystal structure of SM1-71 bound to TAK1-TAB1
• 5JK3 2.37 Å, Crystal structure of TL11-128 bound to TAK1-TAB1
• 4O91 2.39 Å, Crystal Structure of type II inhibitor NG25 bound to TAK1-TAB1
• 9FPD 2.4 Å, Crystal structure of human TAK1/TAB1 fusion protein in complex with compound S1

Browse structure collections

About this viewer

MolViewer shows 8GW3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.