8HLO: ASAP1-SH3 and MICAL1-PRM complex

Crystal structure of ASAP1-SH3 and MICAL1-PRM complex. Determined by X-ray diffraction at 1.17 Å resolution. Released 22 Feb 2023.

Method: X-ray diffraction
Resolution: 1.17 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 776
Mol. weight: 9.04 kDa
Released: 22 Feb 2023

Explore 8HLO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HLO contains 3 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1089-1092	4	1
β-strand	1096	1	2
β-strand	1103	1	1
α-helix	1104-1105	2
β-strand	1106	1	2
β-strand	1111-1117	7	1
β-strand	1122-1127	6	1
β-strand	1130-1138	9	1
α-helix	1139-1141	3
β-strand	1142-1145	4	1

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	829-835	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1	A	protein	67	Mus musculus	Q9QWY8 (AlphaFold model)
Proline rich motif from MICAL1	C	protein	13	Homo sapiens	Q8TDZ2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8HLO_1 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (chains A)
GPGSEFVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVS
FVHILSD

Sequence of entity 2 (C), FASTA

>8HLO_2 Proline rich motif from MICAL1 (chains C)
GPGSEPPPKPPRS

Primary citation

Crystal Structure of the SH3 Domain of ASAP1 in Complex with the Proline Rich Motif (PRM) of MICAL1 Reveals a Unique SH3/PRM Interaction Mode. Jia, X., Lin, L., Xu, S. et al. Int J Mol Sci (2023) 24. DOI 10.3390/ijms24021414 · PubMed

Other PDB entries of the same protein (UniProt Q9QWY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5C79 1.6 Å, PH domain of ASAP1 in complex with diC4-PtdIns(4,5)P2
5C6R 1.8 Å, Crystal structure of PH domain of ASAP1
8ZE8 2.07 Å, Arf-GTPase activating protein Asap1 SH3 domain in complex with 440 Kd Ankyrin-B fragment

Browse structure collections

About this viewer

MolViewer shows 8HLO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.