8ZE8: Arf-GTPase activating protein Asap1 SH3 domain

Arf-GTPase activating protein Asap1 SH3 domain in complex with 440 Kd Ankyrin-B fragment. Determined by X-ray diffraction at 2.07 Å resolution. Released 12 Mar 2025.

Method: X-ray diffraction
Resolution: 2.07 Å
Organisms: Mus musculus, Homo sapiens
Chains: 8
Atoms: 2,547
Mol. weight: 37.1 kDa
Released: 12 Mar 2025

Explore 8ZE8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ZE8 contains 12 α-helices and 32 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1089-1092	4	1
β-strand	1096	1	2
β-strand	1103	1	1
α-helix	1104-1105	2
β-strand	1106	1	2
β-strand	1111-1119	9	1
β-strand	1122-1127	6	1
β-strand	1130-1138	9	1
α-helix	1139-1141	3
β-strand	1142-1146	5	1

Chains B and D: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1089-1092	4	3
β-strand	1096	1	4
β-strand	1103	1	3
α-helix	1104-1105	2
β-strand	1106	1	4
β-strand	1111-1119	9	3
β-strand	1122-1127	6	3
β-strand	1130-1138	9	3
α-helix	1139-1141	3
β-strand	1142-1144	3	3

Chains C, E, F and H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1701-1705	5

Chain G: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	1089-1092	4	7
β-strand	1096	1	8
β-strand	1103	1	7
α-helix	1104-1105	2
β-strand	1106	1	8
β-strand	1111-1117	7	7
β-strand	1122-1127	6	7
β-strand	1130-1138	9	7
α-helix	1139-1141	3
β-strand	1142-1144	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1	A, B, D, G	protein	69	Mus musculus	Q9QWY8 (AlphaFold model)
Ankyrin-2	C, E, F, H	protein	12	Homo sapiens	Q01484 (AlphaFold model)

Sequence of entity 1 (A, B, D, G), FASTA

>8ZE8_1 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 (chains A, B, D, G)
GPGSGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFP
VSFVHILSD

Sequence of entity 2 (C, E, F, H), FASTA

>8ZE8_2 Ankyrin-2 (chains C, E, F, H)
GIKKPVRRKLKE

Primary citation

New targets and designed inhibitors of ASAP Arf-GAPs derived from structural characterization of the ASAP1/440-kD ankyrin-B interaction. Li, Y., Zhao, Y., He, Y. et al. J Biol Chem (2024) 300:107762-107762. DOI 10.1016/j.jbc.2024.107762 · PubMed

Other PDB entries of the same protein (UniProt Q9QWY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HLO 1.17 Å, Crystal structure of ASAP1-SH3 and MICAL1-PRM complex
5C79 1.6 Å, PH domain of ASAP1 in complex with diC4-PtdIns(4,5)P2
5C6R 1.8 Å, Crystal structure of PH domain of ASAP1

Browse structure collections

About this viewer

MolViewer shows 8ZE8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.