8HMT: The complex of ACK1 with the inhibitor 2-142

The complex of ACK1 with the inhibitor 2-142. Determined by X-ray diffraction at 3.17 Å resolution. Released 13 Dec 2023.

Method

X-ray diffraction

Resolution

3.17 Å

Organism

Homo sapiens

Chains

4

Atoms

8,730

Mol. weight

127.26 kDa

Ligands

LWX

Released

13 Dec 2023

Explore 8HMT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HMT contains 69 α-helices and 56 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 14 β-strands

Molecules and chains

>8HMT_1 Activated CDC42 kinase 1 (chains A, B, C, D)
LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIR
EVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQV
AEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAW
CAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDC
PQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQ

Ligands and cofactors

Primary citation

The complex of ACK1 with the inhibitor 2-142. Zhu, S., Xiaoyun, X.Y. To be published.

Related structures

Other PDB entries of the same protein (UniProt Q07912 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 4HZR 1.31 Å, Crystal structure of Ack1 kinase domain
• 8THA 1.68 Å, 1TEL, non-compressed, double-helical crystal form
• 7KP6 1.79 Å, Structure of Ack1 kinase in complex with a selective inhibitor
• 8Q5P 1.81 Å, Structure of the lysine methyltransferase SETD2 in complex with a peptide derived from…
• 1U46 2.0 Å, Crystal Structure of the Unphosphorylated Kinase Domain of the Tyrosine Kinase ACK1
• 3EQR 2.0 Å, Crystal Structure of Ack1 with compound T74
• 1U4D 2.1 Å, Structure of the ACK1 Kinase Domain bound to Debromohymenialdisine
• 5ZXB 2.2 Å, Crystal structure of ACK1 with compound 10d
• 3EQP 2.3 Å, Crystal Structure of Ack1 with compound T95
• 4EWH 2.5 Å, Co-crystal structure of ACK1 with inhibitor
• 8FZ3 2.78 Å, Sterile Alpha Motif of Human Translocation ETS Leukemia, Non-Polymer Crystal Form
• 1U54 2.8 Å, Crystal Structures of the Phosphorylated and Unphosphorylated Kinase Domains of the…

Browse structure collections

About this viewer

MolViewer shows 8HMT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.