8FZ3: PDB entry 8FZ3

Sterile Alpha Motif of Human Translocation ETS Leukemia, Non-Polymer Crystal Form. Determined by X-ray diffraction at 2.78 Å resolution. Released 29 Mar 2023.

Method: X-ray diffraction
Resolution: 2.78 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,484
Mol. weight: 79.41 kDa
Ligands: PO4
Released: 29 Mar 2023

Explore 8FZ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FZ3 contains 30 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	18-20	3
α-helix	23-25	3
α-helix	28-41	14
α-helix	44-46	3
α-helix	56-60	5
α-helix	64-70	7
α-helix	75-86	12

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	18-20	3
α-helix	23-25	3
α-helix	28-42	15
α-helix	44-46	3
α-helix	56-60	5
α-helix	64-70	7
α-helix	75-86	12

Chain C: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	17-19	3
α-helix	23-25	3
α-helix	28-42	15
α-helix	44-46	3
α-helix	50-52	3
α-helix	56-59	4
α-helix	64-70	7
α-helix	75-86	12

Chain D: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	17-19	3
α-helix	23-25	3
α-helix	28-42	15
α-helix	44-46	3
α-helix	49-52	4
α-helix	56-59	4
α-helix	64-70	7
α-helix	75-85	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6, Activated CDC42 kinase 1 fusion	A, B, C, D	protein	170	Homo sapiens	P41212 (AlphaFold model), Q07912 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8FZ3_1 Transcription factor ETV6, Activated CDC42 kinase 1 fusion (chains A, B, C, D)
GHHHHHHHHHHSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALL
LLTKEDFRYRSPHSGDELYELLQHILKQGPADKIQMAMVHGVTTEECQAALQCHGWSVQR
AAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSWGPAHHKR

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Sterile Alpha Motif of Human Translocation ETS Leukemia, Non-Polymer Crystal Form, With Disordered Human ACK1 UBA Domain Fused to C-terminus. Averett, J.C., Nawarathnage, S.D., Moody, J.D. To be published.

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM

Browse structure collections

About this viewer

MolViewer shows 8FZ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.