Crystal structure of the MlaD domain of the MlaD protein from Escherichia coli (Form II). Determined by X-ray diffraction at 2.7 Å resolution. Released 10 Jan 2024.
Explore 8HQ9 in 3D Show helices and sheets RCSB PDB PDBe
8HQ9 contains 10 α-helices and 60 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-45 | 7 | 1 |
| β-strand | 57-60 | 4 | 1 |
| β-strand | 63-73 | 11 | 1 |
| β-strand | 80-87 | 8 | 1 |
| β-strand | 94 | 1 | 2 |
| β-strand | 98-103 | 6 | 1 |
| β-strand | 110-115 | 6 | 1 |
| α-helix | 116-118 | 3 | |
| α-helix | 121-123 | 3 | |
| β-strand | 127 | 1 | 2 |
| β-strand | 133 | 1 | 1 |
| β-strand | 136-138 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-45 | 7 | 5 |
| β-strand | 57-60 | 4 | 5 |
| β-strand | 63-73 | 11 | 5 |
| β-strand | 80-87 | 8 | 5 |
| β-strand | 94 | 1 | 6 |
| β-strand | 98-103 | 6 | 5 |
| β-strand | 110-115 | 6 | 5 |
| α-helix | 121-123 | 3 | |
| β-strand | 127 | 1 | 6 |
| β-strand | 132-133 | 2 | 5 |
| β-strand | 136-138 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-45 | 7 | 9 |
| β-strand | 57-60 | 4 | 9 |
| β-strand | 63-73 | 11 | 9 |
| β-strand | 80-87 | 8 | 9 |
| β-strand | 94 | 1 | 10 |
| β-strand | 98-103 | 6 | 9 |
| β-strand | 110-115 | 6 | 9 |
| α-helix | 116-118 | 3 | |
| β-strand | 127 | 1 | 10 |
| β-strand | 133 | 1 | 9 |
| β-strand | 136-138 | 3 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-45 | 7 | 11 |
| β-strand | 57-60 | 4 | 11 |
| β-strand | 63-73 | 11 | 11 |
| β-strand | 80-87 | 8 | 11 |
| β-strand | 94 | 1 | 12 |
| β-strand | 98-103 | 6 | 11 |
| β-strand | 110-115 | 6 | 11 |
| α-helix | 116-118 | 3 | |
| α-helix | 121-123 | 3 | |
| β-strand | 127 | 1 | 12 |
| β-strand | 132-133 | 2 | 11 |
| β-strand | 136-138 | 3 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Intermembrane phospholipid transport system binding protein MlaD | A, B, C, D, E, F | protein | 162 | Escherichia coli K-12 | P64604 (AlphaFold model) |
>8HQ9_1 Intermembrane phospholipid transport system binding protein MlaD (chains A, B, C, D, E, F) MHHHHHHANVTSIRTEPTYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTYLPR VTLEIEQRYNHIPDTSSLSIRTSGLLGEQYLALNVGFEDPELGTAILKDGDTIQDTKSAM VLEDLIGQFLYGSKGDDNKNSGDAPAAAPGNNETTEPVGTTK
The Structural Features of MlaD Illuminate its Unique Ligand-Transporting Mechanism and Ancestry. Dutta, A., Kanaujia, S.P. Protein J (2024) 43:298-315. DOI 10.1007/s10930-023-10179-5 · PubMed
Other PDB entries of the same protein (UniProt P64604 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8HQ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.