8HQA: PDB entry 8HQA

Crystal structure of the ectodomain of the MlaD protein from Escherichia coli in the resting state. Determined by X-ray diffraction at 3.2 Å resolution. Released 10 Jan 2024.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Escherichia coli K-12
Chains: 3
Atoms: 2,673
Mol. weight: 52.39 kDa
Released: 10 Jan 2024

Explore 8HQA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HQA contains 9 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	1
β-strand	57-60	4	1
β-strand	63-73	11	1
β-strand	80-87	8	1
β-strand	94	1	2
β-strand	98-103	6	1
β-strand	110-115	6	1
α-helix	116-119	4
β-strand	127	1	2
β-strand	132-134	3	1
β-strand	136-138	3	1
α-helix	139-141	3
α-helix	143-151	9

Chain B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	3
β-strand	57-60	4	3
β-strand	63-73	11	3
β-strand	80-87	8	3
β-strand	94	1	4
β-strand	98-103	6	3
β-strand	110-115	6	3
α-helix	116-118	3
β-strand	127	1	4
β-strand	132-134	3	3
β-strand	136-138	3	3
α-helix	139-141	3
α-helix	143-151	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Intermembrane phospholipid transport system binding protein MlaD	A, B, C	protein	162	Escherichia coli K-12	P64604 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8HQA_1 Intermembrane phospholipid transport system binding protein MlaD (chains A, B, C)
MHHHHHHANVTSIRTEPTYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTYLPR
VTLEIEQRYNHIPDTSSLSIRTSGLLGEQYLALNVGFEDPELGTAILKDGDTIQDTKSAM
VLEDLIGQFLYGSKGDDNKNSGDAPAAAPGNNETTEPVGTTK

Primary citation

The Structural Features of MlaD Illuminate its Unique Ligand-Transporting Mechanism and Ancestry. Dutta, A., Kanaujia, S.P. Protein J (2024) 43:298-315. DOI 10.1007/s10930-023-10179-5 · PubMed

Other PDB entries of the same protein (UniProt P64604 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HPZ 2.3 Å, Crystal structure of the MlaD domain of the MlaD protein from Escherichia coli (Form I)
8HQ9 2.7 Å, Crystal structure of the MlaD domain of the MlaD protein from Escherichia coli (Form II)
7CGE 2.9 Å, The overall structure of nucleotide free MlaFEDB complex
6XBD 3.05 Å, Cryo-EM structure of MlaFEDB in nanodiscs with phospholipid substrates
6ZY3 3.3 Å, Cryo-EM structure of MlaFEDB in complex with phospholipid
6ZY9 3.3 Å, Cryo-EM structure of MlaFEDB in complex with AMP-PNP
6ZY2 3.6 Å, Cryo-EM structure of apo MlaFEDB
7CH0 3.7 Å, The overall structure of the MlaFEDB complex in ATP-bound EQclose conformation (Mutation…
6ZY4 4.1 Å, Cryo-EM structure of MlaFEDB in complex with ADP
7CGN 4.3 Å, The overall structure of the MlaFEDB complex in ATP-bound EQtall conformation (Mutation…
8OJ4 4.35 Å, Structure of the MlaCD complex (1:6 stoichiometry)
8OJG 4.38 Å, Structure of the MlaCD complex (2:6 stoichiometry)

Browse structure collections

About this viewer

MolViewer shows 8HQA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.