8HXC: MPXV M2 heptamer

Cryo-EM structure of MPXV M2 heptamer in complex with human B7.2. Determined by electron microscopy at 3.12 Å resolution. Released 30 Aug 2023.

Method: Electron microscopy
Resolution: 3.12 Å
Organisms: Monkeypox virus, Homo sapiens
Chains: 14
Atoms: 17,374
Mol. weight: 333.94 kDa
Released: 30 Aug 2023

Explore 8HXC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HXC contains 42 α-helices and 175 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F and G: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	1
α-helix	24-27	4
β-strand	33-43	11	2
β-strand	44	1	3
α-helix	51-52	2
β-strand	57-62	6	4
β-strand	67-73	7	4
β-strand	76-82	7	4
β-strand	89-97	9	2
β-strand	101-108	8	2
β-strand	119-125	7	4
β-strand	131	1	5
β-strand	133-140	8	4
α-helix	141	1
β-strand	148-154	7	4
β-strand	158	1	3
β-strand	160-165	6	2
β-strand	181-184	4	2
α-helix	188-190	3
β-strand	192-197	6	2
β-strand	214-216	3	2

Chains H, I, J, K, L, M and N: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	35-39	5	29
α-helix	50-52	3
β-strand	54-58	5	2
β-strand	64-68	5	2
β-strand	73	1	2
α-helix	80-82	3
β-strand	86-89	4	29
β-strand	94-98	5	29
β-strand	108-114	7	2
β-strand	120-128	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NFkB inhibitor	A, B, C, D, E, F, G	protein	203	Monkeypox virus	A0A7H0DN11
T-lymphocyte activation antigen CD86	H, I, J, K, L, M, N	protein	213	Homo sapiens	P42081 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>8HXC_1 NFkB inhibitor (chains A, B, C, D, E, F, G)
VEYKNTICPPRQDYRYWYFVAELTIGVNYDINSTIIGECHMSESYIDRNANIVLTGYGLK
INMTIMDTDQRFVAAAEGVGKDNKLSVLLFTTQRLDKVHHNISVTITCMEMNCGTTKYNS
DLPESIHKSSSCDITINGSCVTCVNLETDPTKINPHYLHPKNKYLYHNSEYSMRGSYGVT
FIDELNQCLLDIKELSYDICYRE

Sequence of entity 2 (H, I, J, K, L, M, N), FASTA

>8HXC_2 T-lymphocyte activation antigen CD86 (chains H, I, J, K, L, M, N)
LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGR
TSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPIS
NITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSV
SFPDVTSNMTIFCILETDKTRLLSSPFSIELED

Primary citation

Structural and functional insights into the modulation of T cell costimulation by monkeypox virus protein M2. Yang, S., Wang, Y., Yu, F. et al. Nat Commun (2023) 14:5186-5186. DOI 10.1038/s41467-023-40748-2 · PubMed

Other PDB entries of the same protein (UniProt A0A7H0DN11), best resolution first:

8HXB 2.7 Å, Cryo-EM structure of MPXV M2 hexamer in complex with human B7.2
8HXA 3.04 Å, Cryo-EM structure of MPXV M2 in complex with human B7.1

Browse structure collections

About this viewer

MolViewer shows 8HXC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.