8HZ8: PPIA

Structure of PPIA in complex with the peptide of NRF2. Determined by X-ray diffraction at 1.81 Å resolution. Released 13 Mar 2024.

Method: X-ray diffraction
Resolution: 1.81 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,304
Mol. weight: 18.29 kDa
Released: 13 Mar 2024

Explore 8HZ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8HZ8 contains 3 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	1
β-strand	15-24	10	1
α-helix	30-41	12
β-strand	52	1	1
β-strand	55-57	3	1
β-strand	61-64	4	1
β-strand	77	1	2
β-strand	80	1	2
β-strand	83	1	3
β-strand	97-100	4	1
β-strand	102	1	4
β-strand	108	1	3
β-strand	112-115	4	1
α-helix	120-122	3
β-strand	128-134	7	1
α-helix	136-143	8
β-strand	156-163	8	1

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase A, N-terminally processed	A	protein	164	Homo sapiens	P62937 (AlphaFold model)
NRF2 peptide	C	protein	4	synthetic construct	Q16236 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8HZ8_1 Peptidyl-prolyl cis-trans isomerase A, N-terminally processed (chains A)
VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFM
CQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEW
LDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Sequence of entity 2 (C), FASTA

>8HZ8_2 NRF2 peptide (chains C)
VAPV

Primary citation

PPIA dictates NRF2 stability to promote lung cancer progression. Lu, W., Cui, J., Wang, W. et al. Nat Commun (2024) 15:4703-4703. DOI 10.1038/s41467-024-48364-4 · PubMed

Other PDB entries of the same protein (UniProt P62937 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E3S 1.08 Å, Tricomplex of RMC-9945, KRAS G12N, and CypA
9BG4 1.14 Å, Tri-complex of Compound-2, KRAS G12V, and CypA
4N1M 1.15 Å, Structure of Cyclophilin A in complex with GlyPro.
5F66 1.15 Å, High-resolution isotropic multiconformer synchrotron model of CypA at 273 K
9GHY 1.15 Å, Cyclophilin A in complex with Sanglifehrin A analogue (2R,3S,7S,10S,E)-10-(3-aminopropyl)…
6GJL 1.16 Å, Cyclophilin A complexed with tri-vector ligand 10.
6GS6 1.16 Å, Cyclophilin A single mutant D66A in complex with an inhibitor.
2X25 1.2 Å, Free acetyl-CypA orthorhombic form
4YUO 1.2 Å, High-resolution multiconformer synchrotron model of CypA at 273 K
7UXM 1.2 Å, Structure of PPIA in complex with FP29092, a Helicon Polypeptide
8TBG 1.2 Å, Tricomplex of RMC-7977, HRAS WT, and CypA
9BFV 1.2 Å, Tri-complex of Compound-23, KRAS G12C, and CypA

Browse structure collections

About this viewer

MolViewer shows 8HZ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.