8IR2: SLF1 BRCT domain

Crystal structure of the SLF1 BRCT domain in complex with a Rad18 peptide containing pS442 and pS444. Determined by X-ray diffraction at 1.75 Å resolution. Released 15 Nov 2023.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,061
Mol. weight: 52.42 kDa
Ligands: MG, IPA
Released: 15 Nov 2023

Explore 8IR2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8IR2 contains 26 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
α-helix	17-27	11
β-strand	33-34	2	1
β-strand	45-48	4	1
β-strand	53	1	2
α-helix	55-62	8
β-strand	66-68	3	1
α-helix	71-79	9
α-helix	86-88	3
β-strand	89	1	1
α-helix	102-118	17
β-strand	128-132	5	3
α-helix	140-148	9
β-strand	152-153	2	3
β-strand	165-168	4	3
α-helix	171-173	3
α-helix	176-179	4
α-helix	185	1
β-strand	186-188	3	3
α-helix	190-197	8

Chain B: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	4
α-helix	17-27	11
β-strand	33-34	2	4
β-strand	45-48	4	4
β-strand	53	1	5
α-helix	55-62	8
β-strand	66-68	3	4
α-helix	71-79	9
α-helix	82-84	3
α-helix	86-88	3
β-strand	89	1	4
α-helix	102-118	17
β-strand	128-132	5	6
α-helix	137-148	12
α-helix	151	1
β-strand	152-153	2	6
α-helix	154	1
β-strand	165-168	4	6
α-helix	170-179	10
α-helix	185	1
β-strand	186-188	3	6
α-helix	190-197	8

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	438-440	3
β-strand	445	1	2
α-helix	446-451	6

Chain D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	438-440	3
β-strand	445	1	5
α-helix	446-450	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SMC5-SMC6 complex localization factor protein 1	A, B	protein	207	Homo sapiens	Q9BQI6 (AlphaFold model)
Ser-asp-ser-cys-asn-ser-sep-ser-sep-asp-ile-ile-arg-asp-leu-leu-glu	C, D	protein	17	Homo sapiens	Q9NS91 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8IR2_1 SMC5-SMC6 complex localization factor protein 1 (chains A, B)
MEDGTPKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA
CAAGKWILTKDYIIHSAKSGRWLDETTYEWGYKIEKDSRYSPQMQSAPKRWREELKRTGA
PGAFHRWKVVLLVRTDKRSDSLIRVLEAGKANVILPKSSPSGITHVIASNARIKAEKEKD
NFKAPFYPIQYLGDFLLEKLEHHHHHH

Sequence of entity 2 (C, D), FASTA

>8IR2_2 SER-ASP-SER-CYS-ASN-SER-SEP-SER-SEP-ASP-ILE-ILE-ARG-ASP-LEU-LEU-GLU (chains C, D)
SDSCNSSSSDIIRDLLE

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
IPA	Isopropyl alcohol	C3 H8 O	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural insights into Rad18 targeting by the SLF1 BRCT domains. Huang, W., Qiu, F., Zheng, L. et al. J Biol Chem (2023) 299:105288-105288. DOI 10.1016/j.jbc.2023.105288 · PubMed

Other PDB entries of the same protein (UniProt Q9BQI6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PEF 1.28 Å, Crystal structure of SLF1 Ankyrin repeat domain in complex with H4 tail (K20me0)
8IR4 1.62 Å, Crystal structure of the SLF1 BRCT domain in complex with a Rad18 peptide containing pS442

Browse structure collections

About this viewer

MolViewer shows 8IR2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.