Crystal structure of SLF1 Ankyrin repeat domain in complex with H4 tail (K20me0). Determined by X-ray diffraction at 1.28 Å resolution. Released 9 Oct 2024.
Explore 8PEF in 3D Show helices and sheets RCSB PDB PDBe
8PEF contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 810-817 | 8 | |
| α-helix | 820-827 | 8 | |
| α-helix | 844-851 | 8 | |
| α-helix | 854-863 | 10 | |
| β-strand | 873 | 1 | 1 |
| β-strand | 876 | 1 | 1 |
| α-helix | 878-884 | 7 | |
| α-helix | 888-898 | 11 | |
| α-helix | 900-904 | 5 | |
| α-helix | 913-916 | 4 | |
| α-helix | 920-929 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SMC5-SMC6 complex localization factor protein 1 | A | protein | 136 | Homo sapiens | Q9BQI6 (AlphaFold model) |
| Histone H4 | B | protein | 17 | Homo sapiens | P62805 (AlphaFold model) |
>8PEF_1 SMC5-SMC6 complex localization factor protein 1 (chains A) GSMKTNLKGETALHRACINNQVEKLILLLSLPGIDINVKDNAGWTPLHEACNYGNTVCVQ EILQRCPEVDLLTQVDGVTPLHDALSNGHVEIGKLLLQHGGPVLLQQRNAKGELPLDYVV SPQIKEELFAITKIED
>8PEF_2 Histone H4 (chains B) GLGKGGAKRHRKVLRDN
Structural mechanisms of SLF1 interactions with Histone H4 and RAD18 at the stalled replication fork. Ryder, E.L., Nasir, N., Durgan, A.E.O. et al. Nucleic Acids Res (2024) 52:12405-12421. DOI 10.1093/nar/gkae831 · PubMed
Other PDB entries of the same protein (UniProt Q9BQI6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8PEF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.