Crystal structure of the SLF1 BRCT domain in complex with a Rad18 peptide containing pS442. Determined by X-ray diffraction at 1.62 Å resolution. Released 15 Nov 2023.
Explore 8IR4 in 3D Show helices and sheets RCSB PDB PDBe
8IR4 contains 24 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| α-helix | 17-27 | 11 | |
| β-strand | 33-34 | 2 | 1 |
| β-strand | 45-48 | 4 | 1 |
| β-strand | 53 | 1 | 2 |
| α-helix | 55-62 | 8 | |
| β-strand | 66-68 | 3 | 1 |
| α-helix | 71-79 | 9 | |
| α-helix | 86-88 | 3 | |
| β-strand | 89 | 1 | 1 |
| α-helix | 102-118 | 17 | |
| β-strand | 128-132 | 5 | 3 |
| α-helix | 140-148 | 9 | |
| β-strand | 152-153 | 2 | 3 |
| β-strand | 165-168 | 4 | 3 |
| α-helix | 171-173 | 3 | |
| α-helix | 176-179 | 4 | |
| α-helix | 185 | 1 | |
| β-strand | 186-188 | 3 | 3 |
| α-helix | 190-197 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 4 |
| α-helix | 17-27 | 11 | |
| β-strand | 33-34 | 2 | 4 |
| β-strand | 45-48 | 4 | 4 |
| β-strand | 53 | 1 | 5 |
| α-helix | 55-62 | 8 | |
| β-strand | 66-68 | 3 | 4 |
| α-helix | 71-79 | 9 | |
| α-helix | 82-84 | 3 | |
| α-helix | 86-88 | 3 | |
| β-strand | 89 | 1 | 4 |
| α-helix | 102-118 | 17 | |
| β-strand | 128-131 | 4 | 6 |
| α-helix | 137-148 | 12 | |
| β-strand | 152-153 | 2 | 6 |
| α-helix | 154-155 | 2 | |
| β-strand | 165-167 | 3 | 6 |
| α-helix | 170-179 | 10 | |
| α-helix | 185 | 1 | |
| β-strand | 186-187 | 2 | 6 |
| α-helix | 189-197 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 438-440 | 3 | |
| β-strand | 445 | 1 | 2 |
| α-helix | 446-451 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 445 | 1 | 5 |
| α-helix | 446-449 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SMC5-SMC6 complex localization factor protein 1 | A, B | protein | 207 | Homo sapiens | Q9BQI6 (AlphaFold model) |
| Ser-asp-ser-cys-asn-ser-sep-ser-ser-asp-ile-ile-arg-asp-leu-leu-glu | C, D | protein | 17 | Homo sapiens | Q9NS91 (AlphaFold model) |
>8IR4_1 SMC5-SMC6 complex localization factor protein 1 (chains A, B) MEDGTPKHIIQMTGFKMEEKEALVKLLLKLDCTFIKSEKYKNCTHLIAERLCKSEKFLAA CAAGKWILTKDYIIHSAKSGRWLDETTYEWGYKIEKDSRYSPQMQSAPKRWREELKRTGA PGAFHRWKVVLLVRTDKRSDSLIRVLEAGKANVILPKSSPSGITHVIASNARIKAEKEKD NFKAPFYPIQYLGDFLLEKLEHHHHHH
>8IR4_2 SER-ASP-SER-CYS-ASN-SER-SEP-SER-SER-ASP-ILE-ILE-ARG-ASP-LEU-LEU-GLU (chains C, D) SDSCNSSSSDIIRDLLE
Water and common crystallization additives (CL) are not listed.
Structural insights into Rad18 targeting by the SLF1 BRCT domains. Huang, W., Qiu, F., Zheng, L. et al. J Biol Chem (2023) 299:105288-105288. DOI 10.1016/j.jbc.2023.105288 · PubMed
Other PDB entries of the same protein (UniProt Q9BQI6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8IR4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.