8IW5: Liprin-beta H2H3 dimer

Name: PDB 8IW5: Crystal structure of liprin-beta H2H3 dimer
Published: 2023-11-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: protein binding

Crystal structure of liprin-beta H2H3 dimer. Determined by X-ray diffraction at 1.7 Å resolution. Released 8 Nov 2023.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Mus musculus
Chains: 2
Atoms: 770
Mol. weight: 11.47 kDa
Ligands: CA
Released: 8 Nov 2023

Explore 8IW5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8IW5 contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	43-60	18
α-helix	64-73	10
α-helix	76-86	11

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	46-60	15
α-helix	64-72	9
α-helix	76-86	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Liprin-beta-1	A, B	protein	51	Mus musculus	Q8C8U0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8IW5_1 Liprin-beta-1 (chains A, B)
GPGSMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAEVLIEWLQNQ

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

KANK1 shapes focal adhesions by orchestrating protein binding, mechanical force sensing, and phase separation. Guo, K., Zhang, J., Huang, P. et al. Cell Rep (2023) 42:113321-113321. DOI 10.1016/j.celrep.2023.113321 · PubMed

Other PDB entries of the same protein (UniProt Q8C8U0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IW0 2.1 Å, Crystal structure of the KANK1/liprin-beta1 complex
3TAD 2.9 Å, Crystal Structure of the Liprin-alpha/Liprin-beta complex

Browse structure collections

About this viewer

MolViewer shows 8IW5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.