8IW0: KANK1/liprin-beta1 complex

Name: PDB 8IW0: Crystal structure of the KANK1/liprin-beta1 complex
Published: 2023-11-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: protein binding

Crystal structure of the KANK1/liprin-beta1 complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 8 Nov 2023.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 2,583
Mol. weight: 43.07 kDa
Released: 8 Nov 2023

Explore 8IW0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8IW0 contains 12 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-21	17
α-helix	257-281	25
α-helix	283-311	29

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-21	17
α-helix	257-281	25
α-helix	284-310	27

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-21	17
α-helix	257-281	25
α-helix	284-308	25

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-21	17
α-helix	257-280	24
α-helix	283-306	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Liprin-beta-1,KN motif and ankyrin repeat domain-containing protein 1	A, B, C, D	protein	96	Mus musculus, Homo sapiens	Q14678 (AlphaFold model), Q8C8U0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8IW0_1 Liprin-beta-1,KN motif and ankyrin repeat domain-containing protein 1 (chains A, B, C, D)
MMSDASDMLAAALEQMDGIIAGSGSGSSPMHLQHIREQMAIALKRLKELEEQVRTIPVLQ
VKISVLQEEKRQLVSQLKNQRAASQINGLEHHHHHH

Primary citation

KANK1 shapes focal adhesions by orchestrating protein binding, mechanical force sensing, and phase separation. Guo, K., Zhang, J., Huang, P. et al. Cell Rep (2023) 42:113321-113321. DOI 10.1016/j.celrep.2023.113321 · PubMed

Other PDB entries of the same protein (UniProt Q14678 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YBU 1.89 Å, Structure of the KANK1 ankyrin domain in complex with KIF21A peptide
5YBJ 2.34 Å, Structure of apo KANK1 ankyrin domain
8IVZ 2.8 Å, Crystal structure of talin R7 in complex with KANK1 KN motif
8AS9 3.4 Å, Crystal structure of the talin-KANK1 complex

Browse structure collections

About this viewer

MolViewer shows 8IW0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.