8J8L: Overall structure of the LAT1-4F2hc

Overall structure of the LAT1-4F2hc bound with L-dopa. Determined by electron microscopy at 3.56 Å resolution. Released 17 Jul 2024.

Method: Electron microscopy
Resolution: 3.56 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,361
Mol. weight: 129.24 kDa
Ligands: DAH
Released: 17 Jul 2024

Explore 8J8L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8J8L contains 45 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	167-173	7
α-helix	180-206	27
α-helix	219-221	3
β-strand	225-227	3	1
α-helix	231-234	4
α-helix	242-247	6
α-helix	249-255	7
β-strand	261-262	2	1
α-helix	263-264	2
β-strand	266-267	2	2
β-strand	277-281	5	2
α-helix	288-301	14
β-strand	306-308	3	1
α-helix	325-341	17
β-strand	345-349	5	1
α-helix	351-353	3
α-helix	357-371	15
β-strand	376-380	5	1
α-helix	386-392	7
β-strand	400-402	3	1
α-helix	413-427	15
β-strand	432	1	3
α-helix	442-444	3
α-helix	451-459	9
β-strand	463	1	3
β-strand	466-468	3	1
α-helix	488-490	3
α-helix	510-513	4
α-helix	520-531	12
α-helix	535-539	5
β-strand	541-545	5	4
β-strand	551-557	7	4
β-strand	563-569	7	4
β-strand	575-576	2	5
α-helix	586-588	3
α-helix	589-591	3
β-strand	593-594	2	6
β-strand	595-599	5	4
β-strand	610-611	2	6
β-strand	616-617	2	5
β-strand	621-627	7	4

Chain B: 24 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	52-63	12
α-helix	67-69	3
α-helix	73-78	6
α-helix	82-109	28
α-helix	118-123	6
α-helix	127-135	9
α-helix	136-140	5
α-helix	141-157	17
α-helix	158-160	3
α-helix	165-167	3
α-helix	168-188	21
α-helix	190-220	31
α-helix	244-246	3
α-helix	247-250	4
α-helix	270-297	28
α-helix	302-306	5
α-helix	311-320	10
α-helix	326-356	31
β-strand	366	1	7
α-helix	374-388	15
α-helix	397-421	25
α-helix	434-450	17
α-helix	455-472	18
α-helix	473-477	5
α-helix	483-499	17
β-strand	503	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2 cell-surface antigen heavy chain	A	protein	647	Homo sapiens	P08195 (AlphaFold model)
Large neutral amino acids transporter small subunit 1	B	protein	527	Homo sapiens	Q01650 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8J8L_1 4F2 cell-surface antigen heavy chain (chains A)
MAHHHHHHHHHHSGRELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSETGSDCVTQ
AGLQLLASSDPPALASKNAEVTVETGFHHVSQADIEFLTSIDPTASASGSAGITGTMSQD
TEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLS
KEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALY
RIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFG
SKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGF
QVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYL
SDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPV
FSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRR
LSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPA
SASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAALE

Sequence of entity 2 (B), FASTA

>8J8L_2 Large neutral amino acids transporter small subunit 1 (chains B)
MADYKDDDDKSGPDEVDASGRAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGE
GEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGA
LCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPL
FPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIG
KGDVSNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIII
SLPIVTLVYVLTNLAYFTTLSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVN
GSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFF
SFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGI
GFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQET

Ligands and cofactors

ID	Name	Formula	Copies
DAH	3,4-dihydroxyphenylalanine	C9 H11 N O4	1

Primary citation

Structural insights into the substrate transport mechanism of the amino acid transporter complex. Yang, H., Shi, T., Dong, J. et al. J Biol Chem (2025) 301:110569-110569. DOI 10.1016/j.jbc.2025.110569 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu

Browse structure collections

About this viewer

MolViewer shows 8J8L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.