8J97: Muscarinic receptor

Structure of Muscarinic receptor (M2R) in complex with beta-arrestin1 (Local refine, cross-linked). Determined by electron microscopy at 3.2 Å resolution. Released 27 Dec 2023.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: Bos taurus, Mus musculus, Homo sapiens
Chains: 4
Atoms: 3,863
Mol. weight: 65.25 kDa
Released: 27 Dec 2023

Explore 8J97 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8J97 contains 15 α-helices and 54 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	18-22	5	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	36-43	8	1
α-helix	46-48	3
β-strand	52-61	10	4
β-strand	77-87	11	4
α-helix	99-108	10
β-strand	112-118	7	1
α-helix	119-120	2
α-helix	123-125	3
β-strand	127-129	3	4
β-strand	141-151	11	4
α-helix	157-158	2
β-strand	164-168	5	4
β-strand	169-171	3	2
α-helix	173-175	3
β-strand	184-188	5	5
β-strand	197-203	7	5
β-strand	207-208	2	6
α-helix	212-213	2
β-strand	214-218	5	5
β-strand	221-222	2	5
β-strand	227-241	15	7
β-strand	249-258	10	7
β-strand	262	1	7
β-strand	267	1	5
β-strand	270-274	5	5
α-helix	279-281	3
β-strand	288-290	3	4
α-helix	299	1
β-strand	300	1	4
α-helix	301-306	6
β-strand	317-330	14	7
β-strand	344-349	6	7
β-strand	350-351	2	6
α-helix	353-356	4

Chain H: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	8
β-strand	14	1	9
β-strand	20-28	9	8
β-strand	35-42	8	10
β-strand	48-55	8	10
β-strand	60-63	4	10
β-strand	71-76	6	8
α-helix	77-79	3
β-strand	81-87	7	8
α-helix	91-93	3
β-strand	95-103	9	10
β-strand	112-113	2	10
β-strand	117-119	3	10
β-strand	120	1	9

Chain L: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	11
β-strand	11-13	3	12
β-strand	20-25	6	11
β-strand	30	1	13
β-strand	32	1	13
β-strand	34-39	6	12
α-helix	44-45	2
β-strand	46-50	5	12
β-strand	54-55	2	12
β-strand	63-66	4	11
β-strand	71-76	6	11
α-helix	81-83	3
β-strand	86-91	6	12
β-strand	98-99	2	12
β-strand	103-106	4	12

Chain V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	308-310	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	353	Bos taurus	P17870 (AlphaFold model)
Fab30 Heavy Chain	H	protein	117	Mus musculus
Fab30 Light Chain	L	protein	106	Mus musculus
Muscarinic acetylcholine receptor M2	V	protein	9	Homo sapiens	P08172 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8J97_1 Beta-arrestin-1 (chains A)
GTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYG
REDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLP
CSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTA
ETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLF
NTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASST
LLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPK

Sequence of entity 2 (H), FASTA

>8J97_2 Fab30 Heavy Chain (chains H)
VQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGYTYYA
DSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVTV

Sequence of entity 3 (L), FASTA

>8J97_3 Fab30 Light Chain (chains L)
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEI

Sequence of entity 4 (V), FASTA

>8J97_4 Muscarinic acetylcholine receptor M2 (chains V)
ENTVSTSLG

Primary citation

Molecular insights into atypical modes of beta-arrestin interaction with seven transmembrane receptors. Maharana, J., Sano, F.K., Sarma, P. et al. Science (2024) 383:101-108. DOI 10.1126/science.adj3347 · PubMed

Other PDB entries of the same protein (UniProt P17870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G4M 1.9 Å, Crystal structure of bovine beta-arrestin 1
1G4R 2.2 Å, Crystal structure of bovine beta-arrestin 1
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1
1JSY 2.9 Å, Crystal structure of bovine arrestin-2
1ZSH 2.9 Å, Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
22CR 2.9 Å, C5a-desArg bound C5aR2 in complex with beta-arrestin1

Browse structure collections

About this viewer

MolViewer shows 8J97 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.