8JAF: Muscarinic receptor

Structure of Muscarinic receptor (M2R) in complex with beta-arrestin1 (Local Refine, non-cross linked). Determined by electron microscopy at 3.1 Å resolution. Released 27 Dec 2023.

Method: Electron microscopy
Resolution: 3.1 Å
Organisms: Bos taurus, Mus musculus, Homo sapiens
Chains: 4
Atoms: 3,862
Mol. weight: 65.59 kDa
Released: 27 Dec 2023

Explore 8JAF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JAF contains 12 α-helices and 54 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	7-9	3	1
β-strand	12	1	1
β-strand	19-22	4	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	36-42	7	1
β-strand	53-62	10	4
β-strand	76-84	9	4
α-helix	88-90	3
α-helix	99-107	9
β-strand	112-118	7	1
α-helix	119-120	2
β-strand	127-129	3	5
β-strand	141	1	4
β-strand	144-150	7	4
β-strand	164-168	5	4
β-strand	169-171	3	2
β-strand	184-188	5	6
β-strand	197-202	6	6
β-strand	207-209	3	7
β-strand	214-222	9	6
β-strand	228-242	15	8
β-strand	248-256	9	8
β-strand	266-274	9	6
α-helix	278-281	4
β-strand	288-290	3	5
α-helix	291-292	2
α-helix	299	1
β-strand	300	1	5
α-helix	301-304	4
β-strand	316-329	14	8
β-strand	342-349	8	8
β-strand	350-352	3	7

Chain H: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	9
β-strand	14	1	10
β-strand	21-28	8	9
α-helix	32-34	3
β-strand	35-42	8	11
β-strand	48-55	8	11
α-helix	56-58	3
β-strand	62-63	2	11
β-strand	71-76	6	9
β-strand	81-86	6	9
α-helix	91-93	3
β-strand	95-103	9	11
α-helix	104-106	3
β-strand	110-113	4	11
β-strand	117-119	3	11
β-strand	120	1	10

Chain L: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	12
β-strand	11-13	3	13
β-strand	21	1	14
β-strand	23-25	3	12
β-strand	34-39	6	13
β-strand	45-50	6	13
β-strand	54-55	2	13
α-helix	56	1
β-strand	63-64	2	14
β-strand	67-68	2	12
β-strand	71-72	2	12
β-strand	75-76	2	14
β-strand	86-91	6	13
β-strand	99	1	13
β-strand	103-106	4	13

Chain V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	309-311	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	358	Bos taurus	P17870 (AlphaFold model)
Fab30 heavy chain	H	protein	117	Mus musculus
Fab30 light chain	L	protein	106	Mus musculus
Muscarinic acetylcholine receptor M2	V	protein	7	Homo sapiens	P08172 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8JAF_1 Beta-arrestin-1 (chains A)
GTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCAFRYG
REDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLP
CSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTA
ETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLF
NTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASST
LLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPH

Sequence of entity 2 (H), FASTA

>8JAF_2 Fab30 heavy chain (chains H)
VQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGYTYYA
DSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVTV

Sequence of entity 3 (L), FASTA

>8JAF_3 Fab30 light chain (chains L)
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEI

Sequence of entity 4 (V), FASTA

>8JAF_4 Muscarinic acetylcholine receptor M2 (chains V)
TVSTSLG

Primary citation

Molecular insights into atypical modes of beta-arrestin interaction with seven transmembrane receptors. Maharana, J., Sano, F.K., Sarma, P. et al. Science (2024) 383:101-108. DOI 10.1126/science.adj3347 · PubMed

Other PDB entries of the same protein (UniProt P17870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G4M 1.9 Å, Crystal structure of bovine beta-arrestin 1
1G4R 2.2 Å, Crystal structure of bovine beta-arrestin 1
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1
1JSY 2.9 Å, Crystal structure of bovine arrestin-2
1ZSH 2.9 Å, Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
22CR 2.9 Å, C5a-desArg bound C5aR2 in complex with beta-arrestin1

Browse structure collections

About this viewer

MolViewer shows 8JAF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.