8JH7: FZD6 in inactive state

FZD6 in inactive state. Determined by electron microscopy at 3.2 Å resolution. Released 17 Jan 2024.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: Homo sapiens, synthetic construct, Escherichia coli
Chains: 4
Atoms: 7,663
Mol. weight: 136.45 kDa
Released: 17 Jan 2024

Explore 8JH7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JH7 contains 33 α-helices and 63 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 24 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	174	1
α-helix	175-177	3
β-strand	184	1	16
α-helix	193-210	18
α-helix	214-223	10
α-helix	229-231	3
α-helix	233-254	22
β-strand	260-261	2	16
β-strand	272-273	2	16
β-strand	275	1	17
α-helix	283-311	29
α-helix	317-321	5
α-helix	324-331	8
α-helix	334-341	8
β-strand	348-349	2	17
β-strand	358-359	2	17
α-helix	365-367	3
α-helix	368-372	5
α-helix	373-394	22
α-helix	1002-1023	22
α-helix	1030-1048	19
α-helix	1064-1084	21
α-helix	1090-1097	8
α-helix	1099-1104	6
α-helix	1108-1117	10
α-helix	411-439	29
α-helix	442-452	11
α-helix	470-472	3
α-helix	473-485	13
α-helix	486-488	3

Chain H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	13-15	3	2
β-strand	22-28	7	1
β-strand	36-42	7	2
β-strand	48-55	8	2
β-strand	62-63	2	2
α-helix	65-67	3
β-strand	72-76	5	1
β-strand	81-85	5	1
α-helix	91-93	3
β-strand	95-102	8	2
α-helix	108-111	4
β-strand	117	1	2
β-strand	121-125	5	2
β-strand	131	1	3
β-strand	134-138	5	4
α-helix	139-141	3
β-strand	151-159	9	4
β-strand	160	1	3
β-strand	165-168	4	5
β-strand	177-179	3	4
α-helix	180-182	3
β-strand	183-184	2	4
β-strand	190-197	8	4
α-helix	201-204	4
β-strand	208-213	6	5
β-strand	214	1	6
β-strand	219	1	6
β-strand	222-225	4	5

Chain K: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	10-12	3	8
β-strand	19-25	7	7
β-strand	33-39	7	9
β-strand	46-51	6	9
β-strand	58-60	3	9
β-strand	70-73	4	7
β-strand	78-82	5	7
β-strand	93-99	7	9
β-strand	115-116	2	9
β-strand	117-119	3	8

Chain L: 3 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	10
β-strand	11-14	4	11
β-strand	20-26	7	10
β-strand	34-39	6	11
β-strand	46-50	5	11
β-strand	54-55	2	11
β-strand	57	1	12
β-strand	59	1	12
β-strand	63-68	6	10
β-strand	71-76	6	10
β-strand	86-91	6	11
β-strand	99-100	2	11
β-strand	104-108	5	11
β-strand	118-120	3	13
α-helix	121-123	3
α-helix	124-129	6
β-strand	131-137	7	13
β-strand	141	1	14
β-strand	146-151	6	15
β-strand	156	1	15
β-strand	161-165	5	13
β-strand	175	1	14
β-strand	177-184	8	13
α-helix	185-188	4
β-strand	193-200	8	15
β-strand	207-212	6	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
anti-BRIL Fab Heavy chain	H	protein	240	Homo sapiens
anti-Fab Nanobody	K	protein	127	synthetic construct
anti-BRIL Fab Light chain	L	protein	212	Homo sapiens
Frizzled-6,Soluble cytochrome b562	D	protein	641	Homo sapiens, Escherichia coli	O60353 (AlphaFold model), P0ABE7 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>8JH7_1 anti-BRIL Fab Heavy chain (chains H)
EVQLVESGGGLVQPGGSLRLSCAASGFNVVDFSLHWVRQAPGKGLEWVAYISSSSGSTSY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARWGYWPGEPWWKAFDYWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSLEVLFQGPHHHHHH

Sequence of entity 2 (K), FASTA

>8JH7_2 anti-Fab Nanobody (chains K)
HHHHHHQVQLQESGGGLVQPGGSLRLSCAASGRTISRYAMSWFRQAPGKEREFVAVARRS
GDGAFYADSVQGRFTVSRDDAKNTVYLQMNSLKPEDTAVYYCAIDSDTFYSGSYDYWGQG
TQVTVSS

Sequence of entity 3 (L), FASTA

>8JH7_3 anti-BRIL Fab Light chain (chains L)
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQYLYYSLVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNR

Sequence of entity 4 (D), FASTA

>8JH7_4 Frizzled-6,Soluble cytochrome b562 (chains D)
MKTIIALSYIFCLVFADYKDDDDKHHHHHHHHHHENLYFQGHSLFTCEPITVPRCMKMAY
NMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRK
LCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDI
GFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTF
LTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGS
QNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGF
LTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVA
RRQLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSP
EMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLERARSTLEEK
LKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKA
RPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRN

Primary citation

A framework for Frizzled-G protein coupling and implications to the PCP signaling pathways. Zhang, Z., Lin, X., Wei, L. et al. Cell Discov (2024) 10:3-3. DOI 10.1038/s41421-023-00627-y · PubMed

Other PDB entries of the same protein (UniProt O60353 (AlphaFold model), which also has an AlphaFold model), best resolution first:

25GN 3.2 Å, receptor-arrestin
8JHB 3.3 Å, FZD6 Gs complex

Browse structure collections

About this viewer

MolViewer shows 8JH7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.