8JI0: TcsH-CROP

Cryo-EM structure of the TcsH-CROP in complex with TMPRSS2. Determined by electron microscopy at 3.0 Å resolution. Released 20 Mar 2024.

Method: Electron microscopy
Resolution: 3.0 Å
Organisms: Homo sapiens, Escherichia coli (strain K12), Paeniclostridium sordellii
Chains: 2
Atoms: 3,934
Mol. weight: 134.45 kDa
Released: 20 Mar 2024

Explore 8JI0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JI0 contains 13 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2462-2466	5	7
β-strand	2469-2473	5	7
β-strand	2479	1	7
β-strand	2484-2486	3	8
β-strand	2489-2491	3	8
β-strand	2493	1	9
α-helix	2499	1
β-strand	2500	1	9
α-helix	2501	1
β-strand	2502-2507	6	10
β-strand	2510-2515	6	10
β-strand	2518-2519	2	10
β-strand	2522-2523	2	11
β-strand	2532-2533	2	11
β-strand	2547	1	11
β-strand	2553-2557	5	12
β-strand	2560-2564	5	12
β-strand	2570	1	12
β-strand	2573-2577	5	13
β-strand	2580-2584	5	13
β-strand	2591	1	13
β-strand	2595-2597	3	14
β-strand	2604-2606	3	14
β-strand	2612-2613	2	14

Chain B: 11 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	149-152	4	1
β-strand	157-162	6	1
β-strand	167-170	4	1
β-strand	172	1	1
α-helix	178-185	8
α-helix	186-190	5
β-strand	196-201	6	1
β-strand	211	1	2
α-helix	221-224	4
β-strand	226	1	2
β-strand	235-240	6	1
β-strand	261	1	3
α-helix	262-263	2
β-strand	271-274	4	4
β-strand	279-282	4	4
β-strand	284-287	4	5
β-strand	290-293	4	5
α-helix	295-298	4
β-strand	309-312	4	4
β-strand	316	1	6
α-helix	317-319	3
β-strand	326-327	2	4
β-strand	328-333	6	5
β-strand	347-351	5	5
α-helix	354-357	4
β-strand	365	1	3
α-helix	366-368	3
β-strand	379-383	5	3
β-strand	396	1	6
β-strand	398-405	8	3
α-helix	407-410	4
β-strand	424-428	5	3
α-helix	443	1
β-strand	444-449	6	3
β-strand	452-461	10	3
β-strand	473-476	4	3
α-helix	477-491	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transmembrane protease serine 2	B	protein	424	Homo sapiens	O15393 (AlphaFold model)
Maltose/maltodextrin-binding periplasmic protein,Hemorrhagic toxin	A	protein	786	Escherichia coli (strain K12), Paeniclostridium sordellii	M9ZTT7, P0AEX9 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>8JI0_1 Transmembrane protease serine 2 (chains B)
MGILPSPGMPALLSLVSLLSVLLMGCVAETGHHHHHHWKFMGSKCSNSGIECDSSGTCIN
PSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDM
GYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNL
NSSRQSQIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHW
TAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPN
PGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAG
FLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQM
RADG

Sequence of entity 2 (A), FASTA

>8JI0_2 Maltose/maltodextrin-binding periplasmic protein,Hemorrhagic toxin (chains A)
MASMTGGQQMGRGSHHHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTV
EHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAV
RYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFT
WPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAF
NKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAK
EFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMS
AFWYAVRTAVINAASGRQTVDEALKDAQTGSSSLEVLFQGPEFCTINNEKYYFSYDGILQ
NGYITIGRLNFYFDSNNDSKMTTGVFKGPNGFEYFAPANTYNNNLEGQAIVYQNKFLTIN
GKKYYFDNKSKAVTGWQTIDGKKYYFNPNTAIAAMGWQAIDGKKYYFNPNTAIATTGWQT
IDGKKYYFNPNTAIAATGWQAIDGKKYYFNPNTATTSIGYTTINSKNFYFNNDGIMQLGV
FKGPDGFEYFAPANTHNNNEEGQSITYQNKFLIFNEDVYYFDSSSKAVTGWRTIDDHRFY
FEPNTGIGANGYKTLDGKNFYFRNGLPQFGVFKGPDGFEYFAPANTHNNNEEGQSITYQN
KFLVFLGNRYYFDSSSKAVTGWQTINGNTYYFMPDTAIAAAGGFFTIDGAIYFFGIDGVK
QPGIYG

Primary citation

Molecular basis of TMPRSS2 recognition by Paeniclostridium sordellii hemorrhagic toxin. Zhou, R., He, L., Zhang, J. et al. Nat Commun (2024) 15:1976-1976. DOI 10.1038/s41467-024-46394-6 · PubMed

Other PDB entries of the same protein (UniProt O15393 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8V04 1.58 Å, High resolution TMPRSS2 structure following acylation by nafamostat
8S0L 1.8 Å, Crystal structure of the TMPRSS2 zymogen in complex with the nanobody A07
9JD1 1.9 Å, Crystal structure of TMPRSS2 in complex with Fab
7MEQ 1.95 Å, Crystal structure of human TMPRSS2 in complex with Nafamostat
9JD0 2.0 Å, Crystal structure of TMPRSS2 in complex with nanobody
9U8G 2.0 Å, Crystal structure of TMPRSS2 in complex with nanobody77_10
9E83 2.07 Å, TMPRSS2 crystal structure following acylation by UCSF_157
8V1F 2.19 Å, TMPRSS2 complexed with the noncovalent inhibitor 6-amidino-2-napthol
8S0N 2.3 Å, Crystal structure of the TMPRSS2 zymogen in complex with the nanobody A07
7Y0E 2.39 Å, Crystal structure of TMPRSS2 in complex with Camostat
8HD8 2.4 Å, Crystal structure of TMPRSS2 in complex with 212-148
9IZN 2.4 Å, Crystal structure of HKU1A RBD bound to TMPRSS2

Browse structure collections

About this viewer

MolViewer shows 8JI0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.