8JJ3: Nanodisc (PE:PS:PC) reconstituted GLIC at pH 2.5

Cryo-EM structure of nanodisc (PE:PS:PC) reconstituted GLIC at pH 2.5. Determined by electron microscopy at 2.65 Å resolution. Released 17 Apr 2024.

Method: Electron microscopy
Resolution: 2.65 Å
Organism: Gloeobacter violaceus
Chains: 5
Atoms: 14,635
Mol. weight: 212.15 kDa
Ligands: PEE
Released: 17 Apr 2024

Explore 8JJ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JJ3 contains 67 α-helices and 65 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, D and E: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
β-strand	16-31	16	1
β-strand	36-48	13	1
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	1
β-strand	76-78	3	2
β-strand	81	1	1
β-strand	86-94	9	1
β-strand	99-111	13	1
α-helix	119-121	3
β-strand	123-133	11	2
β-strand	140-144	5	1
β-strand	150-151	2	1
β-strand	160-167	8	2
α-helix	171	1
β-strand	172-176	5	2
β-strand	179-192	14	2
α-helix	197	1
α-helix	198-202	5
α-helix	203-212	10
α-helix	213-217	5
α-helix	221-242	22
α-helix	247-248	2
α-helix	254-281	28
α-helix	285-315	31

Chains B and C: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	15	1
β-strand	16-31	16	5
β-strand	36-48	13	5
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	5
β-strand	76-78	3	6
β-strand	81	1	5
β-strand	86-94	9	5
β-strand	99-111	13	5
α-helix	119-121	3
β-strand	123-133	11	6
β-strand	140-144	5	5
β-strand	150-151	2	5
β-strand	160-167	8	6
α-helix	171	1
β-strand	172-176	5	6
β-strand	179-192	14	6
α-helix	197	1
α-helix	198-202	5
α-helix	203-212	10
α-helix	213-217	5
α-helix	221-242	22
α-helix	247-248	2
α-helix	254-281	28
α-helix	285-315	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proton-gated ion channel	A, B, C, D, E	protein	312	Gloeobacter violaceus	Q7NDN8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>8JJ3_1 Proton-gated ion channel (chains A, B, C, D, E)
VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVK
TYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQ
TLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKL
DYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVET
NLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFL
LANIILAFLFFG

Ligands and cofactors

ID	Name	Formula	Copies
PEE	1,2-dioleoyl-sn-glycero-3-phosphoethanolamine	C41 H78 N O8 P	45

Water and common crystallization additives (CL) are not listed.

Primary citation

Cryo-EM structures of prokaryotic ligand-gated ion channel GLIC provide insights into gating in a lipid environment. Bharambe, N., Li, Z., Seiferth, D. et al. Nat Commun (2024) 15:2967-2967. DOI 10.1038/s41467-024-47370-w · PubMed

Other PDB entries of the same protein (UniProt Q7NDN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9LBD 2.14 Å, Cryo-EM structure of nanodisc (PE:PS:PC) reconstituted GLIC F116A mutant at pH 2.5
6HZW 2.22 Å, THE GLIC PENTAMERIC LIGAND-GATED ION CHANNEL 2.22 resolution
3IGQ 2.3 Å, Crystal structure of the extracellular domain of a bacterial pentameric ligand-gated ion…
6F0U 2.35 Å, GLIC mutant E35A
4HFI 2.4 Å, The GLIC pentameric Ligand-Gated Ion Channel at 2.4 A resolution
6F0R 2.5 Å, GLIC mutant E82Q
6F0Z 2.5 Å, GLIC mutant D88N
6HJZ 2.5 Å, Xray structure of GLIC in complex with succinate
6HZ1 2.5 Å, The glic pentameric ligand-gated ion channel mutant E243C
6HY5 2.58 Å, The glic pentameric ligand-gated ion channel mutant Q193C
3TLW 2.6 Å, The GLIC pentameric Ligand-Gated Ion Channel Loop2-21' oxidized mutant in a…
5IUX 2.6 Å, GLIC-V135C bimane labelled X-ray structure

Browse structure collections

About this viewer

MolViewer shows 8JJ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.