Focused refinement structure of GRK2 in NTSR1-GRK2-Galpha(q) complexes. Determined by electron microscopy at 2.81 Å resolution. Released 9 Aug 2023.
Explore 8JPD in 3D Show helices and sheets RCSB PDB PDBe
8JPD contains 39 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-18 | 15 | |
| α-helix | 24-27 | 4 | |
| α-helix | 34-36 | 3 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-48 | 9 | |
| α-helix | 55-59 | 5 | |
| α-helix | 62-75 | 14 | |
| α-helix | 80-93 | 14 | |
| α-helix | 98-109 | 12 | |
| α-helix | 110-114 | 5 | |
| α-helix | 115-119 | 5 | |
| α-helix | 126-137 | 12 | |
| α-helix | 147-156 | 10 | |
| α-helix | 157-161 | 5 | |
| α-helix | 162-167 | 6 | |
| α-helix | 170-182 | 13 | |
| α-helix | 188-190 | 3 | |
| β-strand | 191-200 | 10 | 1 |
| β-strand | 203-210 | 8 | 1 |
| β-strand | 216-223 | 8 | 1 |
| α-helix | 224-229 | 6 | |
| α-helix | 233-247 | 15 | |
| β-strand | 254 | 1 | 2 |
| β-strand | 257-262 | 6 | 1 |
| β-strand | 266-272 | 7 | 1 |
| β-strand | 278 | 1 | 2 |
| α-helix | 279-286 | 8 | |
| α-helix | 291-310 | 20 | |
| β-strand | 313-314 | 2 | 3 |
| α-helix | 320-322 | 3 | |
| β-strand | 323-325 | 3 | 2 |
| β-strand | 331-333 | 3 | 2 |
| β-strand | 340-341 | 2 | 3 |
| α-helix | 359-362 | 4 | |
| α-helix | 371-386 | 16 | |
| α-helix | 399-402 | 4 | |
| α-helix | 403-407 | 5 | |
| α-helix | 419-428 | 10 | |
| α-helix | 444-448 | 5 | |
| α-helix | 451-453 | 3 | |
| α-helix | 458-463 | 6 | |
| α-helix | 467-468 | 2 | |
| α-helix | 482-485 | 4 | |
| α-helix | 490-493 | 4 | |
| α-helix | 500-503 | 4 | |
| α-helix | 504-506 | 3 | |
| β-strand | 511-512 | 2 | 1 |
| α-helix | 514-524 | 11 | |
| α-helix | 526-547 | 22 | |
| β-strand | 561-567 | 7 | 4 |
| β-strand | 577-583 | 7 | 4 |
| β-strand | 587-591 | 5 | 4 |
| β-strand | 597-602 | 6 | 4 |
| α-helix | 603-605 | 3 | |
| β-strand | 606-614 | 9 | 4 |
| β-strand | 617-624 | 8 | 4 |
| β-strand | 629-633 | 5 | 4 |
| α-helix | 637-658 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-adrenergic receptor kinase 1 | G | protein | 688 | Bos taurus | P21146 (AlphaFold model) |
>8JPD_1 Beta-adrenergic receptor kinase 1 (chains G) ADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQ KLGYLLFRDFCLKHLEEAKPLVEFYEEIKKYEKLETEEERLVCSREIFDTYIMKELLACS HPFSKSAIEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNVE LNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERI MLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEPDMIFYAAEI ILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPEV LQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPEL RSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRDLDWQMVFLQKYPPPLIPPRGEVNAAD AFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKK TKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLL TMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQRV PKMKNKPRSPVVELSKVPLIQRGSANGL
| ID | Name | Formula | Copies |
|---|---|---|---|
| STU | Staurosporine | C28 H26 N4 O3 | 1 |
GPCR activation and GRK2 assembly by a biased intracellular agonist. Duan, J., Liu, H., Zhao, F. et al. Nature (2023) 620:676-681. DOI 10.1038/s41586-023-06395-9 · PubMed
Other PDB entries of the same protein (UniProt P21146 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8JPD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.