8JPS: Atypical chemokine receptor 1

Structure of Duffy Antigen Receptor for Chemokines (DARC)/ACKR1 in complex with the chemokine, CCL7 (Composite map). Determined by electron microscopy at 3.65 Å resolution. Released 31 Jul 2024.

Method: Electron microscopy
Resolution: 3.65 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,616
Mol. weight: 71.34 kDa
Released: 31 Jul 2024

Explore 8JPS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JPS contains 38 α-helices and 15 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	49-50	2
β-strand	51-52	2	4
α-helix	53	1
α-helix	59-61	3
α-helix	63-81	19
α-helix	86-88	3
α-helix	96-112	17
α-helix	113-116	4
α-helix	126-152	27
α-helix	154-157	4
α-helix	163-180	18
α-helix	182-186	5
β-strand	188-192	5	5
β-strand	194-197	4	5
α-helix	204-215	12
α-helix	216-220	5
α-helix	221-226	6
α-helix	245-248	4
α-helix	250-252	3
α-helix	254-267	14
α-helix	276-294	19
α-helix	296-311	16

Chain B: 17 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	49-50	2
β-strand	51	1	1
α-helix	59-61	3
α-helix	63-81	19
α-helix	86-88	3
α-helix	96-112	17
α-helix	113-115	3
α-helix	126-157	32
α-helix	163-180	18
α-helix	182-186	5
β-strand	188-190	3	2
β-strand	195-197	3	2
α-helix	201-203	3
α-helix	204-215	12
α-helix	216-220	5
α-helix	221-225	5
α-helix	245-247	3
α-helix	248-267	20
α-helix	276-294	19
α-helix	296-310	15

Chain C: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	4
β-strand	16	1	6
β-strand	25-30	6	6
β-strand	41-45	5	6
β-strand	50-53	4	6
α-helix	58-66	9

Chain D: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	25-29	5	3
β-strand	41-45	5	3
β-strand	50-53	4	3
α-helix	58-66	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Atypical chemokine receptor 1	A, B	protein	267	Homo sapiens	Q16570 (AlphaFold model)
C-C motif chemokine 7	C, D	protein	63	Homo sapiens	P80098 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8JPS_1 Atypical chemokine receptor 1 (chains A, B)
EAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVG
SALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGL
TLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGL
FGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLL
LNLAEALAILHCVATPLLLALFCHQAT

Sequence of entity 2 (C, D), FASTA

>8JPS_2 C-C motif chemokine 7 (chains C, D)
STTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHL
DKK

Primary citation

Molecular mechanism of distinct chemokine engagement and functional divergence of the human Duffy antigen receptor. Saha, S., Khanppnavar, B., Maharana, J. et al. Cell (2024) 187:4751-4769.e25. DOI 10.1016/j.cell.2024.07.005 · PubMed

Other PDB entries of the same protein (UniProt Q16570 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P93 1.55 Å, Crystal Structure of leukotoxin LukE from Staphylococcus aureus in complex with a…
4NUU 1.95 Å, Heterotrimer structure of Region II from Plasmodium vivax Duffy Binding Protein (PvDBP)…
8A44 2.49 Å, Plasmodium vivax Duffy binding protein region II bound the DARC ectodomain and…
4NUV 2.6 Å, Heterotetramer structure of Region II from Plasmodium vivax Duffy Binding Protein…
8YNF 3.65 Å, Structure of Duffy Antigen Receptor for Chemokines (DARC)/ACKR1 in complex with the…

Browse structure collections

About this viewer

MolViewer shows 8JPS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.