8JS9: SV2A

Cryo-EM structure of SV2A in complex with BoNT/A2 Hc. Determined by electron microscopy at 3.01 Å resolution. Released 1 May 2024.

Method: Electron microscopy
Resolution: 3.01 Å
Organisms: Homo sapiens, Clostridium botulinum
Chains: 2
Atoms: 8,177
Mol. weight: 134.24 kDa
Ligands: NAG
Released: 1 May 2024

Explore 8JS9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JS9 contains 34 α-helices and 53 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	138-159	22
α-helix	163-182	20
α-helix	185-197	13
α-helix	204-207	4
α-helix	210-229	20
α-helix	231-249	19
α-helix	256-269	14
α-helix	272-280	9
α-helix	281-283	3
α-helix	290-294	5
α-helix	295-297	3
α-helix	298-314	17
β-strand	322	1	1
β-strand	330	1	1
α-helix	332-351	20
α-helix	355-357	3
α-helix	358-363	6
α-helix	367-385	19
α-helix	400-402	3
α-helix	419-438	20
α-helix	445-482	38
β-strand	485-496	12	2
β-strand	502-517	16	2
β-strand	520-527	8	2
β-strand	530-532	3	2
β-strand	535-542	8	2
β-strand	545-547	3	2
β-strand	550-552	3	2
β-strand	555-559	5	2
α-helix	563-565	3
β-strand	566-567	2	2
β-strand	570-572	3	2
β-strand	574-577	4	2
α-helix	579-581	3
α-helix	593-604	12
α-helix	608-618	11
α-helix	624-641	18
α-helix	648-675	28
α-helix	682-705	24
α-helix	713-730	18
α-helix	734-735	2

Chain B: 6 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	877-884	8	3
β-strand	887-890	4	3
β-strand	897-900	4	4
β-strand	905-906	2	3
β-strand	914-917	4	3
β-strand	924-927	4	4
α-helix	930-932	3
β-strand	941-948	8	3
α-helix	955-957	3
β-strand	962-968	7	4
β-strand	973-979	7	4
β-strand	982-988	7	4
β-strand	994-1000	7	4
β-strand	1015-1021	7	3
β-strand	1026-1031	6	3
β-strand	1034-1040	7	3
β-strand	1052-1058	7	4
β-strand	1066-1075	10	3
α-helix	1081-1091	11
β-strand	1096	1	5
β-strand	1098	1	6
β-strand	1104	1	6
β-strand	1106	1	7
β-strand	1112-1115	4	8
β-strand	1122-1125	4	8
β-strand	1134-1137	4	8
β-strand	1142-1145	4	2
β-strand	1149-1152	4	2
α-helix	1153	1
β-strand	1159-1164	6	8
β-strand	1173	1	7
β-strand	1175	1	5
β-strand	1178-1186	9	8
β-strand	1189-1190	2	8
β-strand	1192-1194	3	9
β-strand	1195	1	10
β-strand	1204-1205	2	8
β-strand	1207-1209	3	9
α-helix	1211-1213	3
β-strand	1218	1	10
β-strand	1220-1226	7	8
β-strand	1232-1240	9	8
β-strand	1246-1255	10	8
β-strand	1258-1264	7	8
α-helix	1266-1272	7
β-strand	1282-1285	4	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Synaptic vesicle glycoprotein 2A	A	protein	750	Homo sapiens	Q7L0J3 (AlphaFold model)
Botulinum neurotoxin	B	protein	426	Clostridium botulinum	Q45894 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8JS9_1 Synaptic vesicle glycoprotein 2A (chains A)
MDYKDDDDKEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEE
DDDDDFPAPSDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGER
MADGAPLAGVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQWTLYFVL
GLALMADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRR
QCLLISLSVNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEH
LSWLCMFWMIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALT
TQPESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSD
TGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMI
RHLQAVDYASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFE
ECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLINSTFLHNKEGCPLDVTGTGE
GAYMVYFVSFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMI
ALLCLFGGVSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITK
AAPILFASAALALGSSLALKLPETRGQVLQ

Sequence of entity 2 (B), FASTA

>8JS9_2 Botulinum neurotoxin (chains B)
KNIVNTSILSIVYKKDDLIDLSRYGAKINIGDRVYYDSIDKNQIKLINLESSTIEVILKN
AIVYNSMYENFSTSFWIKIPKYFSKINLNNEYTIINCIENNSGWKVSLNYGEIIWTLQDN
KQNIQRVVFKYSQMVNISDYINRWIFVTITNNRLTKSKIYINGRLIDQKPISNLGNIHAS
NKIMFKLDGCRDPRRYIMIKYFNLFDKELNEKEIKDLYDSQSNSGILKDFWGNYLQYDKP
YYMLNLFDPNKYVDVNNIGIRGYMYLKGPRGSVVTTNIYLNSTLYEGTKFIIKKYASGNE
DNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKDDQG
IRNKCKMNLQDNNGNDIGFIGFHLYDNIAKLVASNWYNRQVGKASRTFGCSWEFIPVDDG
WGESSL

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structural basis for antiepileptic drugs and botulinum neurotoxin recognition of SV2A. Yamagata, A., Ito, K., Suzuki, T. et al. Nat Commun (2024) 15:3027-3027. DOI 10.1038/s41467-024-47322-4 · PubMed

Other PDB entries of the same protein (UniProt Q7L0J3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4V11 1.95 Å, Structure of Synaptotagmin-1 with SV2A peptide phosphorylated at Thr84
9OKH 2.39 Å, Cryo-EM structure of human SV2A in complex with UCBJ
9OKG 2.58 Å, Cryo-EM structure of human SV2A in complex with levetiracetam
9OKI 2.67 Å, Cryo-EM structure of human SV2A in complex with UCBJ and UCB1244283
9OKJ 2.68 Å, Cryo-EM structure of human SV2A in complex with padsevonil
9OKF 2.8 Å, Cryo-EM structure of human SV2A in the apo state
8JLE 2.82 Å, Cryo-EM structure of SV2A LD4 in complex with BoNT/A2 Hc in the…
8JLG 2.87 Å, Cryo-EM structure of SV2A in complex with BoNT/A2 Hc
8JLC 2.88 Å, Cryo-EM structure of SV2A in complex with BoNT/A2 Hc and levetiracetam
8JS8 2.88 Å, Cryo-EM structure of SV2A in complex with BoNT/A2 Hc and levetiracetam
8JLH 2.9 Å, Cryo-EM structure of SV2A dimer in complex with BoNT/A2 Hc and levetiracetam
9PC9 2.91 Å, Structure of Synaptic Vesicle Protein 2A Bound to UCB7361

Browse structure collections

About this viewer

MolViewer shows 8JS9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.