Cryo-EM structure of the zebrafish P2X4 receptor in complex with BX430. Determined by electron microscopy at 3.23 Å resolution. Released 18 Oct 2023.
Explore 8JV5 in 3D Show helices and sheets RCSB PDB PDBe
8JV5 contains 30 α-helices and 60 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 44-45 | 2 | |
| α-helix | 46-51 | 6 | |
| β-strand | 58-62 | 5 | 1 |
| β-strand | 64-72 | 9 | 2 |
| β-strand | 75-77 | 3 | 3 |
| β-strand | 85-87 | 3 | 3 |
| β-strand | 93 | 1 | 1 |
| β-strand | 101-114 | 14 | 1 |
| β-strand | 115-120 | 6 | 4 |
| α-helix | 121-123 | 3 | |
| β-strand | 128 | 1 | 4 |
| β-strand | 140 | 1 | 4 |
| β-strand | 147-153 | 7 | 4 |
| β-strand | 161-168 | 8 | 4 |
| α-helix | 175-177 | 3 | |
| α-helix | 183-187 | 5 | |
| β-strand | 189-198 | 10 | 2 |
| β-strand | 203-206 | 4 | 2 |
| α-helix | 214-218 | 5 | |
| β-strand | 223 | 1 | 5 |
| β-strand | 227 | 1 | 5 |
| β-strand | 232-234 | 3 | 2 |
| α-helix | 235-240 | 6 | |
| α-helix | 246-252 | 7 | |
| β-strand | 254-265 | 12 | 1 |
| α-helix | 270-272 | 3 | |
| β-strand | 276-281 | 6 | 1 |
| β-strand | 296-304 | 9 | 1 |
| β-strand | 310-333 | 24 | 1 |
| α-helix | 336-357 | 22 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 43-45 | 3 | |
| α-helix | 46-51 | 6 | |
| β-strand | 58-62 | 5 | 11 |
| β-strand | 64-72 | 9 | 12 |
| β-strand | 75-77 | 3 | 13 |
| β-strand | 85-87 | 3 | 13 |
| β-strand | 93 | 1 | 11 |
| β-strand | 101-114 | 14 | 11 |
| β-strand | 115-120 | 6 | 14 |
| α-helix | 121-123 | 3 | |
| β-strand | 128 | 1 | 14 |
| β-strand | 140 | 1 | 14 |
| β-strand | 147-153 | 7 | 14 |
| β-strand | 161-168 | 8 | 14 |
| α-helix | 175-177 | 3 | |
| α-helix | 183-187 | 5 | |
| β-strand | 189-198 | 10 | 12 |
| β-strand | 203-206 | 4 | 12 |
| α-helix | 214-218 | 5 | |
| β-strand | 223 | 1 | 15 |
| β-strand | 227 | 1 | 15 |
| β-strand | 232-234 | 3 | 12 |
| α-helix | 235-240 | 6 | |
| α-helix | 246-252 | 7 | |
| β-strand | 254-265 | 12 | 11 |
| α-helix | 270-272 | 3 | |
| β-strand | 276-281 | 6 | 11 |
| β-strand | 296-304 | 9 | 11 |
| β-strand | 310-333 | 24 | 11 |
| α-helix | 336-357 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| P2X purinoceptor | A, B, C | protein | 351 | Danio rerio | F8W463 (AlphaFold model) |
>8JV5_1 P2X purinoceptor (chains A, B, C) DSVSQCFFDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVT TKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPAST CTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPPLLADAENF TVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVGEAEEDFQI MAVRGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDG TETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWI
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 9 |
| P73 | 1-[2,6-bis(bromanyl)-4-propan-2-yl-phenyl]-3-pyridin-3-yl-urea | C15 H15 Br2 N3 O | 3 |
Structural insights into the allosteric inhibition of P2X4 receptors. Shen, C., Zhang, Y., Cui, W. et al. Nat Commun (2023) 14:6437-6437. DOI 10.1038/s41467-023-42164-y · PubMed
Other PDB entries of the same protein (UniProt F8W463 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8JV5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.