8OEW: DNA-directed RNA polymerase II subunit RPB1

Structure of the mammalian Pol II-Elongin complex, lacking the ELOA latch (composite structure, structure 2). Determined by electron microscopy at 2.8 Å resolution. Released 18 Oct 2023.

Method: Electron microscopy
Resolution: 2.8 Å
Organisms: Sus scrofa, synthetic construct, Homo sapiens
Chains: 18
Atoms: 35,037
Mol. weight: 691.39 kDa
Ligands: ZN, MG
Released: 18 Oct 2023

Explore 8OEW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8OEW contains 197 α-helices and 238 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 74 helices, 70 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15-16	2	1
β-strand	20-22	3	2
β-strand	25	1	3
α-helix	26-27	2
α-helix	28-34	7
β-strand	47	1	4
β-strand	52	1	4
α-helix	53	1
β-strand	86-95	10	5
α-helix	97-99	3
α-helix	100-109	10
β-strand	110	1	6
β-strand	117	1	6
α-helix	124-132	9
α-helix	137-148	12
β-strand	153	1	7
β-strand	187	1	7
α-helix	188-189	2
β-strand	190-194	5	8
β-strand	197-201	5	8
β-strand	213-216	4	8
α-helix	218-226	9
α-helix	230-235	6
α-helix	245-248	4
β-strand	249-255	7	5
α-helix	275-295	21
α-helix	300-318	19
α-helix	326-328	3
β-strand	329	1	9
α-helix	334	1
β-strand	335	1	9
α-helix	336-337	2
α-helix	339-343	5
α-helix	349-353	5
β-strand	357-359	3	10
β-strand	362-369	8	11
β-strand	377-380	4	11
α-helix	382-387	6
β-strand	389-393	5	12
α-helix	394	1
α-helix	399-408	10
β-strand	416-420	5	12
β-strand	426-428	3	12
α-helix	435-437	3
β-strand	445-449	5	12
α-helix	450	1
β-strand	455-459	5	11
α-helix	466-468	3
β-strand	469-476	8	11
β-strand	482-484	3	11
α-helix	487-489	3
β-strand	500-504	5	11
α-helix	509-518	10
β-strand	520	1	11
α-helix	522-524	3
β-strand	526	1	13
β-strand	533	1	13
α-helix	540-548	9
β-strand	554-555	2	14
α-helix	557-565	9
α-helix	573-574	2
β-strand	575	1	15
α-helix	576-577	2
β-strand	579-581	3	16
β-strand	585	1	16
β-strand	586-587	2	14
α-helix	588-595	8
β-strand	602-605	4	17
β-strand	627-631	5	17
β-strand	634-637	4	17
α-helix	642-645	4
α-helix	652-683	32
β-strand	686	1	18
α-helix	689-691	3
α-helix	696-721	26
α-helix	725-728	4
α-helix	733-759	27
α-helix	765-771	7
α-helix	778-785	8
β-strand	789-790	2	19
β-strand	793	1	20
β-strand	796	1	20
β-strand	822-823	2	19
α-helix	833-868	36
β-strand	872-873	2	21
β-strand	879-880	2	21
β-strand	886-888	3	21
α-helix	891-893	3
β-strand	896	1	22
β-strand	902-905	4	23
α-helix	913-920	8
α-helix	927-933	7
β-strand	934	1	24
α-helix	936-944	9
α-helix	946-969	24
β-strand	976-979	4	23
α-helix	983-993	11
β-strand	1002	1	24
α-helix	1006-1018	13
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1051-1053	3
α-helix	1054-1058	5
α-helix	1062-1077	16
β-strand	1080	1	22
α-helix	1081-1082	2
α-helix	1087-1100	14
α-helix	1121-1128	8
β-strand	1139-1142	4	25
β-strand	1143	1	26
α-helix	1145-1148	4
α-helix	1151-1161	11
β-strand	1164-1165	2	27
β-strand	1170-1177	8	28
α-helix	1190-1196	7
β-strand	1210-1216	7	28
α-helix	1218-1223	6
α-helix	1228-1239	12
β-strand	1244-1248	5	28
β-strand	1255-1260	6	28
α-helix	1281-1293	13
β-strand	1297-1299	3	27
β-strand	1307-1310	4	25
α-helix	1315-1317	3
β-strand	1319-1322	4	29
β-strand	1328-1331	4	29
β-strand	1335-1338	4	25
α-helix	1343-1348	6
β-strand	1352	1	26
β-strand	1358-1359	2	25
α-helix	1362-1369	8
α-helix	1371-1387	17
α-helix	1395-1405	11
β-strand	1408-1409	2	30
α-helix	1416-1419	4
α-helix	1426-1432	7
α-helix	1435-1445	11
β-strand	1448-1449	2	2
α-helix	1454-1459	6
α-helix	1467-1470	4
β-strand	1471-1475	5	31
α-helix	1479-1482	4
β-strand	1484	1	32

Chain B: 56 helices, 84 β-strands

Element	Residues	Length	Sheet
β-strand	93	1	33
α-helix	94-95	2
α-helix	99-113	15
α-helix	118-126	9
α-helix	127-131	5
α-helix	132-138	7
α-helix	140-141	2
β-strand	142-145	4	34
β-strand	160-170	11	34
β-strand	174-176	3	35
β-strand	182-184	3	35
α-helix	187-192	6
β-strand	198-210	13	34
β-strand	217-230	14	34
α-helix	245-250	6
β-strand	262-264	3	36
β-strand	267-271	5	36
β-strand	273-277	5	37
α-helix	278	1
β-strand	283-285	3	38
β-strand	292-300	9	38
α-helix	308-309	2
β-strand	310-317	8	38
β-strand	333-336	4	38
β-strand	340	1	39
β-strand	344-345	2	38
α-helix	346-353	8
α-helix	358-365	8
α-helix	372-384	13
α-helix	391-399	9
β-strand	402	1	39
α-helix	409-418	10
α-helix	419-423	5
α-helix	435-454	20
α-helix	458-460	3
α-helix	465-467	3
β-strand	468-471	4	37
α-helix	473-501	29
α-helix	508-511	4
α-helix	514-527	14
β-strand	530	1	40
β-strand	540	1	40
β-strand	544-546	3	36
α-helix	547-548	2
α-helix	552-559	8
β-strand	561-563	3	37
α-helix	580-582	3
β-strand	586	1	41
β-strand	600-602	3	37
β-strand	603	1	41
β-strand	608-609	2	42
α-helix	616-623	8
α-helix	627	1
β-strand	628-629	2	43
α-helix	635-637	3
β-strand	642-646	5	43
β-strand	649-654	6	43
α-helix	657-669	13
β-strand	679-683	5	43
β-strand	688-692	5	43
β-strand	698-704	7	42
β-strand	705	1	44
β-strand	710	1	44
β-strand	713	1	33
α-helix	714-720	7
α-helix	723-726	4
α-helix	730-735	6
β-strand	739-743	5	42
α-helix	744-747	4
β-strand	752-753	2	42
β-strand	772-773	2	42
α-helix	777-780	4
α-helix	784-786	3
α-helix	791-793	3
β-strand	794	1	45
α-helix	796-805	10
β-strand	809	1	46
β-strand	812	1	47
β-strand	824-828	5	47
β-strand	832	1	48
β-strand	836-837	2	49
α-helix	839-842	4
β-strand	853-859	7	50
β-strand	860	1	18
β-strand	870-874	5	50
α-helix	875-879	5
β-strand	885-894	10	47
β-strand	904-906	3	51
β-strand	914-915	2	51
β-strand	925	1	52
β-strand	930	1	53
β-strand	931	1	52
α-helix	932	1
β-strand	936-937	2	47
β-strand	942-944	3	53
β-strand	946-949	4	51
β-strand	966-968	3	51
β-strand	971-972	2	53
α-helix	973-974	2
β-strand	979-988	10	47
β-strand	994-1004	11	47
β-strand	1011-1014	4	50
β-strand	1019-1026	8	50
β-strand	1033	1	54
α-helix	1038-1040	3
β-strand	1042-1044	3	50
α-helix	1046-1048	3
β-strand	1054	1	45
α-helix	1055-1070	16
β-strand	1074-1075	2	49
α-helix	1085-1093	9
β-strand	1102-1103	2	50
β-strand	1106	1	54
α-helix	1112	1
β-strand	1113	1	54
α-helix	1114	1
α-helix	1117	1
β-strand	1118-1127	10	50
β-strand	1128	1	46
α-helix	1132-1134	3
β-strand	1137-1139	3	11
β-strand	1144	1	55
β-strand	1151	1	55
α-helix	1155-1157	3
α-helix	1159-1160	2
β-strand	1161-1163	3	10
α-helix	1165-1174	10
α-helix	1177-1181	5
α-helix	1182-1186	5
β-strand	1190-1196	7	1
β-strand	1202	1	1
α-helix	1203	1
β-strand	1204-1206	3	56
β-strand	1211-1213	3	56
β-strand	1214	1	57
β-strand	1219	1	57
β-strand	1223-1229	7	1
α-helix	1230-1241	12
β-strand	1244	1	3
β-strand	1247-1249	3	2

Chain C: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	58
β-strand	18-24	7	58
α-helix	28-40	13
β-strand	44-55	12	59
α-helix	61-69	9
β-strand	73	1	60
α-helix	82-84	3
β-strand	98-106	9	59
α-helix	112	1
β-strand	113-116	4	61
α-helix	117-119	3
β-strand	121-122	2	59
β-strand	129	1	60
α-helix	130-132	3
α-helix	147-148	2
β-strand	149-153	5	61
β-strand	158-168	11	59
α-helix	174-176	3
β-strand	179-186	8	58
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	228-235	8	58
α-helix	241-269	29

Chain D: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	72-73	2	31
α-helix	78-90	13
α-helix	101-112	12
α-helix	119-132	14
α-helix	150-156	7
β-strand	161	1	62
β-strand	164	1	62
α-helix	166-179	14

Chain E: 13 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	3-23	21
β-strand	26-27	2	63
α-helix	30-33	4
α-helix	37-43	7
α-helix	56-58	3
β-strand	60-64	5	63
β-strand	71-75	5	63
α-helix	84-96	13
β-strand	101-106	6	63
α-helix	112-121	10
β-strand	126-131	6	63
α-helix	132-135	4
α-helix	139-141	3
β-strand	147-150	4	30
α-helix	151-152	2
α-helix	153-162	10
α-helix	167-169	3
β-strand	172-173	2	30
α-helix	178-183	6
α-helix	185-186	2
β-strand	190-197	8	30
β-strand	201-209	9	30

Chain F: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	56	1	64
α-helix	57-58	2
α-helix	59-74	16
α-helix	77-78	2
β-strand	79	1	32
α-helix	89-98	10
β-strand	104-109	6	31
α-helix	110	1
β-strand	115-119	5	31
α-helix	120-122	3
β-strand	124	1	64

Chain G: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	31
α-helix	15-17	3
α-helix	22-34	13
β-strand	38	1	31
β-strand	44-54	11	31
β-strand	58-59	2	31
α-helix	60	1
β-strand	66-77	12	31
β-strand	83-86	4	65
β-strand	88-92	5	65
β-strand	96-100	5	65
β-strand	105-109	5	65
β-strand	117-120	4	66
β-strand	127-130	4	66
β-strand	136-137	2	66
β-strand	144-152	9	65
β-strand	157-162	6	65

Chain H: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-15	12	16
β-strand	25-32	8	16
β-strand	38-44	7	16
β-strand	55-61	7	16
β-strand	65	1	67
β-strand	74	1	15
β-strand	83	1	67
α-helix	84-87	4
β-strand	90-101	12	16
β-strand	111-118	8	16
β-strand	121-128	8	16
β-strand	140-148	9	16

7 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase II subunit RPB1	A	protein	1970	Sus scrofa	P11414 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	B	protein	1251	Sus scrofa	I3LGP4 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa	I3LCH3 (AlphaFold model)
RNA polymerase II subunit D	D	protein	184	Sus scrofa	A0A287ADR4 (AlphaFold model)
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa	I3LSI7
DNA-directed RNA polymerase II subunit F	F	protein	127	Sus scrofa	A0A4X1VEK9
DNA-directed RNA polymerase II subunit RPB7	G	protein	172	Sus scrofa	A0A4X1VKG7
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa	A0A8W4F9W9
DNA-directed RNA polymerase II subunit RPB11-a	K	protein	117	Sus scrofa	F1RKE4
RNA polymerase II subunit K	L	protein	58	Sus scrofa	A0A4X1TRS6

6 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>8OEW_1 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 2 (B), FASTA

>8OEW_2 DNA-directed RNA polymerase subunit beta (chains B)
MCSTNLSQALAYFRAGANLTAASLWAGFRGSRRIFWERRKRKSLCLALRPGGACWRWLLA
VSCVSLRGLGAPGSCANMYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQ
LDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDG
APSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLL
NGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRS
CLENSSRPTSTIWVSMLARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRD
ILEHIIYDFEDPEMMEMVKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVL
QKEMLPHVGVSDFCETKKAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFL
FRGMFKNLLKEVRIYAQKFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQAR
AGVSQVLNRLTFASTLSHLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLV
KNLALMAYISVGSQPSPILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQL
MNTLRKLRRQMDIIVSEVSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQL
KEREYNNYSWQDLVASGVVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMI
LGVCASIIPFPDHNQSPRNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRS
MEYLRFRELPAGINSIVAIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGF
DQEEVFEKPTRETCQGMRHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGT
NRRYTKRDCSTFLRTSETGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKG
TCGIQYRQEDMPFTCEGITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFN
DAVNVQKISNLLSDYGYHLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRA
RGPIQILNRQPMEGRSRDGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCG
IMAIANTRTHTYECRGCRNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 3 (C), FASTA

>8OEW_3 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 4 (D), FASTA

>8OEW_4 RNA polymerase II subunit D (chains D)
MWGPAQPYSDSALSPKPRPFRAVFRGSALPFPAVRVEVRGRSMAAGGSDPRAGDVEEDAS
QLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRE
TIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKR
SFQY

Sequence of entity 5 (E), FASTA

>8OEW_5 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 6 (F), FASTA

>8OEW_6 DNA-directed RNA polymerase II subunit F (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD

Sequence of entity 7 (G), FASTA

>8OEW_7 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS

Sequence of entity 8 (H), FASTA

>8OEW_8 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 9 (I), FASTA

>8OEW_9 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 10 (J), FASTA

>8OEW_10 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 11 (K), FASTA

>8OEW_11 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 12 (L), FASTA

>8OEW_12 RNA polymerase II subunit K (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8
MG	Magnesium ion	Mg	1

Primary citation

Structure of the transcribing RNA polymerase II-Elongin complex. Chen, Y., Kokic, G., Dienemann, C. et al. Nat Struct Mol Biol (2023) 30:1925-1935. DOI 10.1038/s41594-023-01138-w · PubMed

Other PDB entries of the same protein (UniProt P11414 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OO3 2.8 Å, Pol II-CSB-CSA-DDB1-UVSSA (Structure1)
8OEV 2.86 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, lacking ELOA latch (composite…
7OOP 2.9 Å, Pol II-CSB-CSA-DDB1-UVSSA-PAF-SPT6 (Structure 3)
7OPD 3.0 Å, Pol II-CSB-CRL4CSA-UVSSA-SPT6-PAF (Structure 5)
8OEU 3.04 Å, Structure of the mammalian Pol II-SPT6 complex (composite structure, Structure 4)
8OF0 3.05 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, Structure 1
8P4B 3.2 Å, Structural insights into human co-transcriptional capping - structure 2
7B0Y 3.6 Å, Structure of a transcribing RNA polymerase II-U1 snRNP complex
8P4D 3.6 Å, Structural insights into human co-transcriptional capping - structure 4
8P4C 3.8 Å, Structural insights into human co-transcriptional capping - structure 3
8P4E 3.9 Å, Structural insights into human co-transcriptional capping - structure 5
8P4F 4.0 Å, Structural insights into human co-transcriptional capping - structure 6

Browse structure collections

About this viewer

MolViewer shows 8OEW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.