8OH4: Actin-5C

Subtomogram averaging structure of cofilactin filament inside microtubule lumen of Drosophila S2 cell protrusion. Determined by electron microscopy at 16.5 Å resolution. Released 10 May 2023.

Method: Electron microscopy
Resolution: 16.5 Å
Organism: Drosophila
Chains: 14
Atoms: 15,104
Mol. weight: 432.37 kDa
Released: 10 May 2023

Explore 8OH4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8OH4 contains 206 α-helices and 188 β-strands across 14 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G and H: 22 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
β-strand	17-22	6	1
β-strand	30-33	4	1
β-strand	36-39	4	2
β-strand	54-55	2	2
α-helix	56-61	6
β-strand	66-69	4	2
β-strand	72-73	2	3
β-strand	76-77	2	3
α-helix	80-88	9
α-helix	89-94	6
α-helix	99-101	3
β-strand	104-108	5	1
α-helix	114-122	9
α-helix	123-127	5
β-strand	132-137	6	1
α-helix	138-145	8
β-strand	151-156	6	4
β-strand	161-167	7	4
β-strand	170-171	2	4
α-helix	173-175	3
β-strand	177-179	3	4
α-helix	183-196	14
α-helix	204-217	14
α-helix	224-233	10
β-strand	239-242	4	5
β-strand	248-251	4	5
α-helix	254-260	7
α-helix	265-268	4
α-helix	275-284	10
α-helix	288-295	8
β-strand	298-301	4	4
α-helix	303-305	3
α-helix	310-321	12
β-strand	330-331	2	4
α-helix	336-338	3
α-helix	339-349	11
α-helix	351-356	6
β-strand	358-359	2	1
α-helix	360-366	7
α-helix	370-375	6

Chains I, J, K, L, M and N: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	16
α-helix	9-19	11
β-strand	24-32	9	16
β-strand	36-44	9	16
α-helix	49-57	9
β-strand	65-76	12	16
β-strand	83-94	12	16
α-helix	101-117	17
β-strand	123-127	5	16
α-helix	130-133	4
α-helix	135-143	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-5C	A, B, C, D, E, F, G, H	protein	370	Drosophila	P10987 (AlphaFold model)
Cofilin/actin-depolymerizing factor homolog	I, J, K, L, M, N	protein	148	Drosophila	P45594 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>8OH4_1 Actin-5C (chains A, B, C, D, E, F, G, H)
AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGIL
TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE
TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL
TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDG
QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM
YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES
GPSIVHRKCF

Sequence of entity 2 (I, J, K, L, M, N), FASTA

>8OH4_2 Cofilin/actin-depolymerizing factor homolog (chains I, J, K, L, M, N)
MASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDEKQIDVETVADRNAEYDQFLEDIQKCG
PGECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVG
VQKYIQATDLSEASREAVEEKLRATDRQ

Primary citation

CryoET shows cofilactin filaments inside the microtubule lumen. Santos, C.V., Rogers, S.L., Carter, A.P. bioRxiv (2023). DOI 10.1101/2023.03.31.535077 · PubMed

Other PDB entries of the same protein (UniProt P10987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HF3 1.8 Å, Crystal structure of monomeric Actin in the ADP bound state
2HF4 1.8 Å, Crystal structure of Monomeric Actin in its ATP-bound state
3EKS 1.8 Å, Crystal Structure of Monomeric Actin bound to Cytochalasin D
3MN6 2.0 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
3MN7 2.0 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
3MN9 2.0 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
3EKU 2.5 Å, Crystal Structure of Monomeric Actin bound to Cytochalasin D
3EL2 2.5 Å, Crystal Structure of Monomeric Actin Bound to Ca-ATP
4M63 2.75 Å, Crystal Structure of a Filament-Like Actin Trimer Bound to the Bacterial Effector VopL
3MMV 2.8 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
4JHD 2.91 Å, Crystal Structure of an Actin Dimer in Complex with the Actin Nucleator Cordon-Bleu
4RWT 2.98 Å, Structure of actin-Lmod complex

Browse structure collections

About this viewer

MolViewer shows 8OH4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.