8OI6: Actin, cytoplasmic 1

Cryo-EM structure of the undecorated barbed end of filamentous beta/gamma actin. Determined by electron microscopy at 3.59 Å resolution. Released 9 Aug 2023.

Method: Electron microscopy
Resolution: 3.59 Å
Organisms: Bos taurus, Amanita phalloides
Chains: 7
Atoms: 11,573
Mol. weight: 171.42 kDa
Ligands: ADP, MG
Released: 9 Aug 2023

Explore 8OI6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8OI6 contains 91 α-helices and 85 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-11	4	1
β-strand	16-21	6	1
β-strand	29-32	4	1
β-strand	35-38	4	2
β-strand	53-54	2	2
α-helix	56-60	5
β-strand	65-68	4	2
β-strand	71-72	2	3
β-strand	75-76	2	3
α-helix	79-88	10
α-helix	89-94	6
β-strand	103-107	5	1
α-helix	113-122	10
α-helix	123-127	5
β-strand	131-136	6	1
α-helix	137-145	9
β-strand	149-155	7	4
β-strand	160-166	7	4
β-strand	169-170	2	4
β-strand	176-178	3	4
α-helix	182-192	11
α-helix	193-196	4
α-helix	203-213	11
α-helix	223-232	10
β-strand	238-241	4	5
β-strand	247-250	4	5
α-helix	252-255	4
α-helix	258-261	4
α-helix	264-267	4
α-helix	272-273	2
α-helix	274-284	11
α-helix	290-294	5
β-strand	297-300	4	4
α-helix	302-305	4
α-helix	309-320	12
β-strand	329-330	2	4
α-helix	335-337	3
α-helix	338-348	11
α-helix	351-354	4
β-strand	357-358	2	1
α-helix	359-365	7
α-helix	367-370	4

Chain B: 22 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	6
β-strand	10-11	2	7
β-strand	16-19	4	7
β-strand	29-32	4	7
β-strand	35-38	4	8
α-helix	41-42	2
β-strand	53-54	2	8
α-helix	56-60	5
β-strand	65-68	4	8
β-strand	71-72	2	9
β-strand	75-76	2	9
α-helix	79-88	10
α-helix	89-94	6
β-strand	103-107	5	6
α-helix	113-125	13
β-strand	131-136	6	6
α-helix	137-145	9
β-strand	149-155	7	10
β-strand	160-166	7	10
β-strand	169-170	2	10
α-helix	172-174	3
β-strand	176-178	3	10
α-helix	182-193	12
α-helix	203-216	14
α-helix	223-232	10
β-strand	238-241	4	11
β-strand	247-250	4	11
α-helix	253-256	4
α-helix	258-261	4
α-helix	264-267	4
α-helix	272-273	2
α-helix	274-284	11
α-helix	287-294	8
β-strand	297-300	4	10
α-helix	302-305	4
α-helix	309-320	12
β-strand	329-330	2	10
α-helix	335-337	3
α-helix	338-348	11
α-helix	350-355	6
β-strand	357-358	2	6
α-helix	359-365	7

Chain C: 24 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	12
β-strand	10-11	2	13
β-strand	16-19	4	13
β-strand	29-32	4	13
β-strand	35-38	4	14
β-strand	42	1	4
β-strand	53-54	2	14
α-helix	56-60	5
α-helix	62-64	3
β-strand	65-68	4	14
β-strand	71-72	2	15
β-strand	75-76	2	15
α-helix	79-88	10
α-helix	89-93	5
β-strand	103-107	5	12
α-helix	113-122	10
α-helix	123-127	5
β-strand	131-136	6	12
α-helix	137-144	8
β-strand	150-155	6	16
β-strand	160-165	6	16
α-helix	172-174	3
β-strand	176-178	3	16
α-helix	182-193	12
β-strand	198	1	17
α-helix	203-216	14
α-helix	223-232	10
β-strand	238-241	4	18
β-strand	247-250	4	18
α-helix	253-256	4
α-helix	258-261	4
α-helix	264-267	4
α-helix	272-273	2
α-helix	274-283	10
α-helix	289-295	7
β-strand	297-300	4	16
α-helix	302-305	4
α-helix	309-320	12
β-strand	329-330	2	16
α-helix	335-337	3
α-helix	338-348	11
α-helix	352-355	4
β-strand	357-358	2	12
α-helix	359-365	7
α-helix	367-370	4

Chain D: 22 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	19
β-strand	11	1	20
β-strand	16-19	4	20
β-strand	21	1	19
β-strand	29-32	4	20
β-strand	35-38	4	21
α-helix	41-42	2
β-strand	53-54	2	21
α-helix	56-60	5
α-helix	62-64	3
β-strand	65-68	4	21
β-strand	71	1	22
β-strand	76	1	22
α-helix	79-87	9
α-helix	88-94	7
β-strand	103-107	5	19
α-helix	113-121	9
α-helix	122-126	5
β-strand	131-136	6	19
α-helix	137-144	8
β-strand	151-155	5	23
β-strand	160-163	4	23
β-strand	166	1	24
β-strand	169	1	24
β-strand	176-178	3	23
α-helix	182-193	12
β-strand	198	1	25
α-helix	203-216	14
α-helix	223-232	10
α-helix	234-236	3
β-strand	238-241	4	26
β-strand	247-250	4	26
α-helix	253-256	4
α-helix	258-260	3
α-helix	264-267	4
α-helix	274-284	11
α-helix	287-289	3
α-helix	290-295	6
β-strand	297-300	4	23
α-helix	302-305	4
α-helix	309-320	12
β-strand	329-330	2	23
α-helix	338-348	11
α-helix	350-353	4
β-strand	357-358	2	19

Chains I and J: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3	1	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin, cytoplasmic 1	A, B, C, D	protein	375	Bos taurus	P60712 (AlphaFold model)
Phalloidin	H, I, J	protein	7	Amanita phalloides

Sequence of entity 1 (A, B, C, D), FASTA

>8OI6_1 Actin, cytoplasmic 1 (chains A, B, C, D)
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF

Sequence of entity 2 (H, I, J), FASTA

>8OI6_2 PHALLOIDIN (chains H, I, J)
WXATCPA

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	4
MG	Magnesium ion	Mg	4

Primary citation

Molecular mechanisms of inorganic-phosphate release from the core and barbed end of actin filaments. Oosterheert, W., Blanc, F.E.C., Roy, A. et al. Nat Struct Mol Biol (2023) 30:1774-1785. DOI 10.1038/s41594-023-01101-9 · PubMed

Other PDB entries of the same protein (UniProt P60712 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UB5 2.2 Å, Profilin:actin with a wide open nucleotide cleft
3U4L 2.4 Å, Cryocooled bovine profilin:actin crystal structure to 2.4 A
2BTF 2.55 Å, The structure of crystalline profilin-beta-actin
2OAN 2.61 Å, Structure of oxidized beta-actin
1HLU 2.65 Å, Structure of bovine beta-actin-profilin complex with actin bound ATP phosphates solvent…
9FJY 3.79 Å, Structure of the DNase I- and phalloidin-bound pointed end of F-actin (conformer 2).
7PDZ 3.8 Å, Structure of capping protein bound to the barbed end of a cytoplasmic actin filament
9FJU 3.84 Å, Structure of the DNase I- and phalloidin-bound pointed end of F-actin (conformer 1)

Browse structure collections

About this viewer

MolViewer shows 8OI6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.