8P4F: DNA-directed RNA polymerase II subunit RPB1

Name: PDB 8P4F: Structural insights into human co-transcriptional capping - structure 6
Published: 2023-07-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Structural insights into human co-transcriptional capping - structure 6. Determined by electron microscopy at 4.0 Å resolution. Released 19 Jul 2023.

Method: Electron microscopy
Resolution: 4.0 Å
Organisms: synthetic construct, Sus scrofa, Homo sapiens
Chains: 18
Atoms: 43,686
Mol. weight: 781.42 kDa
Ligands: MGT, ZN, MG, SAM
Released: 19 Jul 2023

Explore 8P4F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8P4F contains 242 α-helices and 306 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 79 helices, 70 β-strands

Element	Residues	Length	Sheet
α-helix	14	1
β-strand	15	1	1
β-strand	21-22	2	2
β-strand	25	1	3
α-helix	26-27	2
α-helix	28-34	7
β-strand	47	1	4
β-strand	52	1	4
α-helix	53	1
β-strand	86-95	10	5
α-helix	100-108	9
β-strand	110	1	6
β-strand	117	1	6
α-helix	124-132	9
α-helix	137-150	14
β-strand	153	1	7
β-strand	187	1	7
β-strand	190-194	5	8
β-strand	197-201	5	8
β-strand	213-216	4	8
α-helix	218-226	9
α-helix	230-235	6
α-helix	245-248	4
β-strand	249-255	7	5
α-helix	258-260	3
β-strand	264-265	2	9
β-strand	271-272	2	9
α-helix	275-295	21
α-helix	300-318	19
α-helix	326-328	3
β-strand	329	1	10
β-strand	335	1	10
α-helix	336	1
α-helix	339-343	5
α-helix	349-355	7
β-strand	357-359	3	11
β-strand	362-369	8	12
β-strand	377-380	4	12
α-helix	382-387	6
β-strand	389-393	5	13
α-helix	399-408	10
β-strand	416-420	5	13
β-strand	426-428	3	13
β-strand	445-449	5	13
α-helix	450	1
β-strand	455-459	5	12
α-helix	466-468	3
β-strand	469-476	8	12
β-strand	482-484	3	12
α-helix	487-489	3
β-strand	500-504	5	12
α-helix	509-518	10
β-strand	520	1	12
α-helix	521-523	3
β-strand	526	1	14
β-strand	533	1	14
α-helix	540-549	10
β-strand	554-555	2	15
α-helix	557-566	10
α-helix	574	1
β-strand	575	1	16
α-helix	576-577	2
β-strand	579-581	3	17
β-strand	585	1	17
β-strand	586-587	2	15
α-helix	588-595	8
β-strand	602-605	4	18
β-strand	627-630	4	18
β-strand	635-637	3	18
α-helix	654-659	6
α-helix	666-677	12
α-helix	680-683	4
α-helix	689-691	3
α-helix	698-721	24
α-helix	725-728	4
α-helix	733-757	25
α-helix	765-771	7
α-helix	778-781	4
α-helix	782-786	5
β-strand	789	1	19
β-strand	792-793	2	20
β-strand	796-797	2	20
α-helix	811	1
β-strand	823	1	19
α-helix	833-868	36
β-strand	872-873	2	21
β-strand	879-880	2	21
β-strand	886-888	3	21
α-helix	891-893	3
β-strand	896	1	22
β-strand	902-905	4	23
α-helix	913-919	7
α-helix	929-933	5
β-strand	934	1	24
α-helix	936-944	9
α-helix	946-969	24
α-helix	971-973	3
β-strand	976-979	4	23
α-helix	983-992	10
α-helix	1001	1
β-strand	1002	1	24
α-helix	1006-1017	12
α-helix	1028-1037	10
α-helix	1039-1048	10
α-helix	1051-1053	3
α-helix	1054-1058	5
α-helix	1062-1077	16
β-strand	1080	1	22
α-helix	1081-1082	2
β-strand	1086	1	21
α-helix	1088-1096	9
α-helix	1098-1101	4
α-helix	1121-1129	9
β-strand	1138-1142	5	25
β-strand	1143	1	26
α-helix	1146-1148	3
α-helix	1151-1161	11
β-strand	1164	1	27
α-helix	1166-1169	4
β-strand	1170-1177	8	28
α-helix	1181-1183	3
α-helix	1190-1198	9
β-strand	1210-1216	7	28
α-helix	1218-1223	6
α-helix	1228-1239	12
α-helix	1240-1242	3
β-strand	1243-1247	5	28
β-strand	1255-1261	7	28
α-helix	1263-1266	4
α-helix	1282-1295	14
β-strand	1299	1	27
β-strand	1306-1310	5	25
β-strand	1320-1322	3	29
β-strand	1328-1330	3	29
α-helix	1331-1332	2
β-strand	1335-1339	5	25
α-helix	1343-1348	6
β-strand	1352	1	26
β-strand	1358-1359	2	25
α-helix	1363-1369	7
α-helix	1371-1386	16
α-helix	1395-1406	12
α-helix	1416-1421	6
α-helix	1426-1429	4
α-helix	1436-1444	9
β-strand	1448-1449	2	2
α-helix	1454-1459	6
β-strand	1472-1475	4	30
α-helix	1479-1481	3

Chain B: 52 helices, 78 β-strands

Element	Residues	Length	Sheet
α-helix	22-36	15
α-helix	41-49	9
α-helix	50-55	6
α-helix	56-60	5
α-helix	63-64	2
β-strand	65-67	3	31
β-strand	83-93	11	31
β-strand	97-99	3	32
β-strand	105-107	3	32
α-helix	110-115	6
β-strand	121-133	13	31
β-strand	139-153	15	31
α-helix	168-173	6
β-strand	185-187	3	33
β-strand	190-193	4	33
α-helix	194-195	2
β-strand	196-200	5	34
β-strand	206-208	3	35
β-strand	215-225	11	35
β-strand	229-240	12	35
α-helix	247-252	6
α-helix	254-255	2
β-strand	256-259	4	35
β-strand	267-268	2	35
α-helix	269-275	7
α-helix	281-288	8
α-helix	295-307	13
α-helix	314-322	9
α-helix	332-341	10
α-helix	342-346	5
α-helix	357-377	21
α-helix	381-384	4
β-strand	391-394	4	34
α-helix	396-423	28
α-helix	437-450	14
β-strand	453	1	36
β-strand	463	1	36
β-strand	468-469	2	33
α-helix	470-471	2
α-helix	475-482	8
β-strand	485-486	2	34
α-helix	503-505	3
β-strand	509	1	37
α-helix	517-519	3
β-strand	523-524	2	34
α-helix	525	1
β-strand	526	1	37
α-helix	527	1
β-strand	531-532	2	38
α-helix	539-546	8
β-strand	551	1	39
β-strand	565-569	5	39
β-strand	572-577	6	39
α-helix	580-593	14
β-strand	602-605	4	39
β-strand	612-615	4	39
β-strand	621-627	7	38
β-strand	628-629	2	40
β-strand	632-633	2	40
α-helix	637-644	8
α-helix	653-657	5
β-strand	662-666	5	38
β-strand	675-676	2	38
α-helix	679-682	4
β-strand	695-696	2	38
α-helix	700-703	4
α-helix	714-716	3
β-strand	717	1	41
α-helix	720-728	9
β-strand	732	1	42
β-strand	748-751	4	43
β-strand	755	1	44
β-strand	759-760	2	45
α-helix	764-766	3
β-strand	776-782	7	46
β-strand	794-797	4	46
α-helix	798-801	4
β-strand	808-817	10	43
β-strand	820	1	47
β-strand	826	1	47
β-strand	827-829	3	48
β-strand	837	1	48
β-strand	853	1	49
α-helix	854-855	2
β-strand	859-860	2	43
β-strand	865-867	3	49
β-strand	869-872	4	48
α-helix	875-878	4
β-strand	889-891	3	48
β-strand	894-895	2	49
α-helix	896-897	2
β-strand	902-911	10	43
β-strand	917-927	11	43
β-strand	934-937	4	46
β-strand	942-949	8	46
α-helix	951-953	3
β-strand	956-957	2	50
β-strand	965-967	3	46
α-helix	971-975	5
β-strand	977	1	41
α-helix	979-992	14
β-strand	997-998	2	45
α-helix	1008-1015	8
α-helix	1016-1018	3
β-strand	1025-1026	2	46
β-strand	1028-1029	2	50
α-helix	1035	1
β-strand	1036	1	50
α-helix	1037	1
β-strand	1041-1050	10	46
β-strand	1051	1	42
β-strand	1060-1062	3	12
β-strand	1067	1	51
β-strand	1074	1	51
α-helix	1075-1076	2
α-helix	1082-1083	2
β-strand	1084-1086	3	11
α-helix	1088-1096	9
α-helix	1100-1104	5
α-helix	1105-1109	5
β-strand	1115-1119	5	1
β-strand	1125	1	1
β-strand	1127-1129	3	52
β-strand	1134-1136	3	52
β-strand	1137	1	53
β-strand	1142	1	53
β-strand	1146-1150	5	1
α-helix	1153-1163	11
β-strand	1167	1	3
β-strand	1170-1171	2	2

Chain C: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	54
β-strand	18-24	7	54
α-helix	28-35	8
β-strand	44-55	12	55
α-helix	61-70	10
β-strand	73	1	56
β-strand	99-106	8	55
α-helix	112	1
β-strand	113-116	4	57
α-helix	117-119	3
β-strand	121-122	2	55
β-strand	129	1	56
α-helix	130-132	3
α-helix	146-148	3
β-strand	149-153	5	57
β-strand	158-168	11	55
α-helix	174-176	3
β-strand	179-186	8	54
α-helix	200-202	3
α-helix	204-206	3
α-helix	218-220	3
β-strand	229-235	7	54
α-helix	242-270	29

Chain D: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	16	1	83
α-helix	17-19	3
β-strand	21	1	83
β-strand	30-32	3	30
α-helix	34-49	16
α-helix	55-58	4
α-helix	59-70	12
α-helix	77-88	12
α-helix	94-103	10
α-helix	108-114	7
α-helix	116-118	3
α-helix	124-137	14

Chain E: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-23	21
β-strand	26	1	58
α-helix	30-33	4
α-helix	37-43	7
β-strand	60-61	2	59
β-strand	64	1	58
β-strand	73-75	3	59
β-strand	81-82	2	60
α-helix	84-97	14
β-strand	101-106	6	59
β-strand	109-110	2	60
α-helix	112-120	9
β-strand	126-131	6	59
α-helix	139-141	3
α-helix	146	1
β-strand	147-150	4	61
α-helix	153-162	10
α-helix	167-169	3
β-strand	172-173	2	61
α-helix	178-182	5
β-strand	190-195	6	61
β-strand	203-209	7	61

Chain F: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	56	1	62
α-helix	61-73	13
α-helix	89-98	10
β-strand	104-109	6	30
α-helix	110	1
β-strand	115-119	5	30
β-strand	124	1	62

Chain G: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	30
α-helix	14	1
α-helix	15-17	3
α-helix	23-34	12
β-strand	38-39	2	30
β-strand	43-54	12	30
α-helix	55-56	2
β-strand	57-59	3	30
α-helix	60	1
β-strand	66-77	12	30
β-strand	84-92	9	81
β-strand	96-101	6	81
β-strand	104-109	6	81
α-helix	110-112	3
β-strand	120	1	82
β-strand	127	1	82
β-strand	142-153	12	81
β-strand	156-162	7	81
β-strand	169-170	2	81

Chain H: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-14	11	17
β-strand	25-31	7	17
β-strand	38-44	7	17
β-strand	55-61	7	17
β-strand	65	1	63
β-strand	74	1	16
β-strand	84	1	63
β-strand	90-101	12	17
β-strand	104	1	64
β-strand	107	1	64
α-helix	108-109	2
β-strand	111-118	8	17
β-strand	121-128	8	17
β-strand	139-148	10	17

7 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA (29-mer)	P	RNA	29	synthetic construct
DNA-directed RNA polymerase II subunit RPB1	A	protein	1970	Sus scrofa	P11414 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	B	protein	1174	Sus scrofa	I3LGP4 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C	protein	275	Sus scrofa	I3LCH3 (AlphaFold model)
DNA-directed RNA polymerase II subunit E	E	protein	210	Sus scrofa	I3LSI7 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F	protein	127	Sus scrofa	A0A4X1VEK9
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H	protein	150	Sus scrofa	I3LCB2
DNA-directed RNA polymerase II subunit RPB9	I	protein	125	Sus scrofa	P60899
DNA-directed RNA polymerases I, II, and III subunit RPABC5	J	protein	67	Sus scrofa	A0A4X1VYD0
DNA-directed RNA polymerase II subunit RPB11-a	K	protein	117	Sus scrofa	F1RKE4
RNA polymerase II subunit K	L	protein	58	Sus scrofa	A0A4X1TRS6
DNA (38-mer)	N	DNA	38	synthetic construct

6 more molecules are not listed.

Sequence of entity 1 (P), FASTA

>8P4F_1 RNA (29-MER) (chains P)
GAUCAAAAAGACAUACAUAAAGACCAGGC

Sequence of entity 2 (A), FASTA

>8P4F_2 DNA-directed RNA polymerase II subunit RPB1 (chains A)
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPTSPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN

Sequence of entity 3 (B), FASTA

>8P4F_3 DNA-directed RNA polymerase subunit beta (chains B)
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVE
DAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTY
SAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLD
PGGYFIINGSEKVLIAQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSML
ARGGQGAKKSAIGQRIVATLPYIKQEVPIIIVFRALGFVSDRDILEHIIYDFEDPEMMEM
VKPSLDEAFVIQEQNVALNFIGSRGAKPGVTKEKRIKYAKEVLQKEMLPHVGVSDFCETK
KAYFLGYMVHRLLLAALGRRELDDRDHYGNKRLDLAGPLLAFLFRGMFKNLLKEVRIYAQ
KFIDRGKDFNLELAIKTRIISDGLKYSLATGNWGDQKKAHQARAGVSQVLNRLTFASTLS
HLRRLNSPIGRDGKLAKPRQLHNTLWGMVCPAETPEGHAVGLVKNLALMAYISVGSQPSP
ILEFLEEWSMENLEEISPAAIADATKIFVNGCWVGIHKDPEQLMNTLRKLRRQMDIIVSE
VSMIRDIREREIRIYTDAGRICRPLLIVEKQKLLLKKRHIDQLKEREYNNYSWQDLVASG
VVEYIDTLEEETVMLAMTPDDLQEKEVAYCSTYTHCEIHPSMILGVCASIIPFPDHNQSP
RNTYQSAMGKQAMGVYITNFHVRMDTLAHVLYYPQKPLVTTRSMEYLRFRELPAGINSIV
AIASYTGYNQEDSVIMNRSAVDRGFFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGM
RHAIYDKLDDDGLIAPGVRVSGDDVIIGKTVTLPENEDELEGTNRRYTKRDCSTFLRTSE
TGIVDQVMVTLNQEGYKFCKIRVRSVRIPQIGDKFASRHGQKGTCGIQYRQEDMPFTCEG
ITPDIIINPHAIPSRMTIGHLIECLQGKVSANKGEIGDATPFNDAVNVQKISNLLSDYGY
HLRGNEVLYNGFTGRKITSQIFIGPTYYQRLKHMVDDKIHSRARGPIQILNRQPMEGRSR
DGGLRFGEMERDCQIAHGAAQFLRERLFEASDPYQVHVCNLCGIMAIANTRTHTYECRGC
RNKTQISLVRMPYACKLLFQELMSMSIAPRMMSV

Sequence of entity 4 (C), FASTA

>8P4F_4 DNA-directed RNA polymerase II subunit RPB3 (chains C)
MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPSDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN

Sequence of entity 5 (E), FASTA

>8P4F_5 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Sequence of entity 6 (F), FASTA

>8P4F_6 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD

Sequence of entity 7 (H), FASTA

>8P4F_7 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

Sequence of entity 8 (I), FASTA

>8P4F_8 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGIVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE

Sequence of entity 9 (J), FASTA

>8P4F_9 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK

Sequence of entity 10 (K), FASTA

>8P4F_10 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE

Sequence of entity 11 (L), FASTA

>8P4F_11 RNA polymerase II subunit K (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

Sequence of entity 12 (N), FASTA

>8P4F_12 DNA (38-MER) (chains N)
AGTACTAGTATTCTAGTATTGAAAGTACTTGAGCTTGA

Ligands and cofactors

ID	Name	Formula	Copies
MGT	7N-methyl-8-hydroguanosine-5'-triphosphate	C11 H20 N5 O14 P3	1
ZN	Zinc ion	Zn	8
MG	Magnesium ion	Mg	1
SAM	S-adenosylmethionine	C15 H22 N6 O5 S	1

Primary citation

Structural insights into human co-transcriptional capping. Garg, G., Dienemann, C., Farnung, L. et al. Mol Cell (2023) 83:2464. DOI 10.1016/j.molcel.2023.06.002 · PubMed

Other PDB entries of the same protein (UniProt P11414 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OO3 2.8 Å, Pol II-CSB-CSA-DDB1-UVSSA (Structure1)
8OEW 2.8 Å, Structure of the mammalian Pol II-Elongin complex, lacking the ELOA latch (composite…
8OEV 2.86 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, lacking ELOA latch (composite…
7OOP 2.9 Å, Pol II-CSB-CSA-DDB1-UVSSA-PAF-SPT6 (Structure 3)
7OPD 3.0 Å, Pol II-CSB-CRL4CSA-UVSSA-SPT6-PAF (Structure 5)
8OEU 3.04 Å, Structure of the mammalian Pol II-SPT6 complex (composite structure, Structure 4)
8OF0 3.05 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, Structure 1
8P4B 3.2 Å, Structural insights into human co-transcriptional capping - structure 2
7B0Y 3.6 Å, Structure of a transcribing RNA polymerase II-U1 snRNP complex
8P4D 3.6 Å, Structural insights into human co-transcriptional capping - structure 4
8P4C 3.8 Å, Structural insights into human co-transcriptional capping - structure 3
8P4E 3.9 Å, Structural insights into human co-transcriptional capping - structure 5

Browse structure collections

About this viewer

MolViewer shows 8P4F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.