8P5P: TECPR1 N-terminal DysF domain

Structure of TECPR1 N-terminal DysF domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 19 Jul 2023.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,103
Mol. weight: 42.44 kDa
Released: 19 Jul 2023

Explore 8P5P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8P5P contains 6 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	66-78	13	1
β-strand	82-84	3	1
α-helix	92-93	2
β-strand	95-96	2	1
β-strand	103	1	1
α-helix	106-108	3
β-strand	116-118	3	1
β-strand	123-124	2	1
β-strand	127-128	2	2
β-strand	131-132	2	2
β-strand	139-141	3	1
β-strand	149	1	1
β-strand	158-169	12	1

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	67-78	12	3
β-strand	82-84	3	3
α-helix	92-93	2
β-strand	95-96	2	3
β-strand	103	1	3
α-helix	106-108	3
α-helix	109-111	3
β-strand	116-118	3	3
β-strand	123-124	2	3
β-strand	127-128	2	4
β-strand	131-132	2	4
β-strand	139-141	3	3
β-strand	149	1	3
β-strand	158-169	12	3

Chain C: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	66-78	13	5
β-strand	82-84	3	5
α-helix	92-93	2
β-strand	95-96	2	5
β-strand	103	1	5
β-strand	117-118	2	5
β-strand	123-124	2	5
β-strand	127-128	2	6
β-strand	131-132	2	6
β-strand	139-141	3	5
β-strand	149	1	5
β-strand	158-168	11	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tectonin beta-propeller repeat-containing protein 1	A, B, C	protein	116	Homo sapiens	Q7Z6L1 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8P5P_1 Tectonin beta-propeller repeat-containing protein 1 (chains A, B, C)
GAASDVPIRRREEAYENQRWNPMGGFCEKLLLSDRWGWSDVSGLQHRPLDRVALPSPHWE
WESDWYVDENFGGEPTEKGGWTYAIDFPATYTKDKKWNSCVRRRKWIRYRRYKSRD

Primary citation

TECPR1 conjugates LC3 to damaged endomembranes upon detection of sphingomyelin exposure. Boyle, K.B., Ellison, C.J., Elliott, P.R. et al. EMBO J (2023) 42:e113012-e113012. DOI 10.15252/embj.2022113012 · PubMed

Other PDB entries of the same protein (UniProt Q7Z6L1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TQ1 1.8 Å, Crystal structure of human ATG5-TECAIR

Browse structure collections

About this viewer

MolViewer shows 8P5P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.