Racemic structure of TNFR1 cysteine-rich domain. Determined by X-ray diffraction at 1.4 Å resolution. Released 24 Jan 2024.
Explore 8P6Q in 3D Show helices and sheets RCSB PDB PDBe
8P6Q contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 78-80 | 3 | |
| β-strand | 83-86 | 4 | 1 |
| β-strand | 95-97 | 3 | 1 |
| β-strand | 103-106 | 4 | 2 |
| β-strand | 112-115 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tumor necrosis factor-binding protein 1 | A | protein | 45 | Homo sapiens | P19438 (AlphaFold model) |
| D-tnfr-1 CRD2 | B | protein | 45 | Homo sapiens |
>8P6Q_1 Tumor necrosis factor-binding protein 1 (chains A) SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFN
>8P6Q_2 D-TNFR-1 CRD2 (chains B) SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFN
Deciphering the Synthetic and Refolding Strategy of a Cysteine-Rich Domain in the Tumor Necrosis Factor Receptor (TNF-R) for Racemic Crystallography Analysis and d-Peptide Ligand Discovery. Lander, A.J., Kong, Y., Jin, Y. et al. ACS Bio Med Chem Au (2024) 4:68-76. DOI 10.1021/acsbiomedchemau.3c00060 · PubMed
Other PDB entries of the same protein (UniProt P19438 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8P6Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.