8PA0: Heat shock protein beta-7

cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex. Determined by X-ray diffraction at 2.85 Å resolution. Released 16 Oct 2024.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,354
Mol. weight: 20.14 kDa
Released: 16 Oct 2024

Explore 8PA0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8PA0 contains 7 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2633	1	4
α-helix	2635-2637	3
β-strand	2639-2641	3	5
α-helix	2643-2645	3
β-strand	2654-2659	6	5
β-strand	2664	1	4
β-strand	2668-2673	6	2
α-helix	2678-2679	2
β-strand	2682-2688	7	5
β-strand	2691-2696	6	5
β-strand	2702-2710	9	2
β-strand	2713-2714	2	2
α-helix	2715	1
α-helix	2718	1
β-strand	2720-2724	5	2

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	86-92	7	1
α-helix	98-100	3
β-strand	102-105	4	2
β-strand	109-117	9	2
β-strand	123-132	10	2
β-strand	137	1	3
α-helix	139-141	3
β-strand	143-146	4	1
β-strand	151-157	7	1
β-strand	158	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein beta-7	B	protein	87	Homo sapiens	Q9UBY9 (AlphaFold model)
Filamin-C	A	protein	98	Homo sapiens	Q14315 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>8PA0_1 Heat shock protein beta-7 (chains B)
GSGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKSQLPE
DVDPTSVTSALREDGSLTIRARRHPHT

Sequence of entity 2 (A), FASTA

>8PA0_2 Filamin-C (chains A)
GSKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHM
GNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFKVKVP

Primary citation

Filamin C dimerisation is regulated by HSPB7. Wang, Z., Cao, G., Collier, M.P. et al. Nat Commun (2025) 16:4090-4090. DOI 10.1038/s41467-025-58889-x · PubMed

Other PDB entries of the same protein (UniProt Q9UBY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RHA 2.18 Å, HSPB7ACD C131S

Browse structure collections

About this viewer

MolViewer shows 8PA0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.