8RHA: HSPB7ACD C131S

HSPB7ACD C131S. Determined by X-ray diffraction at 2.18 Å resolution. Released 16 Oct 2024.

Method: X-ray diffraction
Resolution: 2.18 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,810
Mol. weight: 28.51 kDa
Released: 16 Oct 2024

Explore 8RHA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8RHA contains 7 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	86-91	6	1
α-helix	98-100	3
β-strand	101-106	6	2
β-strand	109-117	9	2
β-strand	123-132	10	2
β-strand	137	1	3
α-helix	139-141	3
β-strand	143-146	4	1
β-strand	152-157	6	1
β-strand	158	1	3

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	82-85	4
β-strand	86-91	6	4
α-helix	98-100	3
β-strand	101-106	6	2
β-strand	109-117	9	2
β-strand	123-132	10	2
β-strand	137	1	5
α-helix	139-141	3
β-strand	143-146	4	4
β-strand	152-157	6	4
β-strand	158	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein beta-7	A, B, C	protein	87	Homo sapiens	Q9UBY9 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>8RHA_1 Heat shock protein beta-7 (chains A, B, C)
GSGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKSQLPE
DVDPTSVTSALREDGSLTIRARRHPHT

Primary citation

Filamin C dimerisation is regulated by HSPB7. Wang, Z., Cao, G., Collier, M.P. et al. Nat Commun (2025) 16:4090-4090. DOI 10.1038/s41467-025-58889-x · PubMed

Other PDB entries of the same protein (UniProt Q9UBY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PA0 2.85 Å, cvHsp (HspB7) C131S alpha-crystallin domain - filamin C (FLNC) domain 24 complex

Browse structure collections

About this viewer

MolViewer shows 8RHA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.