HsNMT1 in complex with both MyrCoA and GNCFSKPR inhibitor peptide. Determined by X-ray diffraction at 1.9 Å resolution. Released 14 Aug 2024.
Explore 8Q26 in 3D Show helices and sheets RCSB PDB PDBe
8Q26 contains 36 α-helices and 50 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 109-113 | 5 | |
| α-helix | 120-122 | 3 | |
| β-strand | 136 | 1 | 1 |
| α-helix | 140-142 | 3 | |
| α-helix | 149-153 | 5 | |
| β-strand | 156-160 | 5 | 2 |
| α-helix | 166-179 | 14 | |
| β-strand | 182 | 1 | 3 |
| β-strand | 188-190 | 3 | 3 |
| α-helix | 194-201 | 8 | |
| α-helix | 208-210 | 3 | |
| β-strand | 211-216 | 6 | 2 |
| β-strand | 222-235 | 14 | 2 |
| β-strand | 238-250 | 13 | 2 |
| α-helix | 252-254 | 3 | |
| α-helix | 259-272 | 14 | |
| β-strand | 279-283 | 5 | 2 |
| β-strand | 292-300 | 9 | 2 |
| α-helix | 303-308 | 6 | |
| α-helix | 320-327 | 8 | |
| β-strand | 338-340 | 3 | 2 |
| α-helix | 343-345 | 3 | |
| α-helix | 346-357 | 12 | |
| β-strand | 362-365 | 4 | 2 |
| α-helix | 368-375 | 8 | |
| β-strand | 378 | 1 | 2 |
| β-strand | 382-388 | 7 | 2 |
| β-strand | 394-402 | 9 | 2 |
| β-strand | 405-407 | 3 | 3 |
| β-strand | 415-416 | 2 | 3 |
| β-strand | 418-421 | 4 | 2 |
| β-strand | 425-426 | 2 | 2 |
| α-helix | 431-444 | 14 | |
| β-strand | 449-453 | 5 | 2 |
| α-helix | 458-460 | 3 | |
| β-strand | 468-469 | 2 | 2 |
| β-strand | 470 | 1 | 4 |
| β-strand | 471-479 | 9 | 2 |
| β-strand | 482 | 1 | 1 |
| α-helix | 488-490 | 3 | |
| β-strand | 491 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 109-113 | 5 | |
| α-helix | 120-122 | 3 | |
| α-helix | 126-127 | 2 | |
| β-strand | 136 | 1 | 5 |
| α-helix | 140-142 | 3 | |
| α-helix | 149-153 | 5 | |
| β-strand | 156-160 | 5 | 6 |
| α-helix | 166-179 | 14 | |
| β-strand | 182 | 1 | 7 |
| β-strand | 188-190 | 3 | 7 |
| α-helix | 194-201 | 8 | |
| α-helix | 208-210 | 3 | |
| β-strand | 211-216 | 6 | 6 |
| β-strand | 222-235 | 14 | 6 |
| β-strand | 238-250 | 13 | 6 |
| α-helix | 252-254 | 3 | |
| α-helix | 259-272 | 14 | |
| β-strand | 279-283 | 5 | 6 |
| β-strand | 292-300 | 9 | 6 |
| α-helix | 303-308 | 6 | |
| α-helix | 314-315 | 2 | |
| α-helix | 320-327 | 8 | |
| β-strand | 338-340 | 3 | 6 |
| α-helix | 343-345 | 3 | |
| α-helix | 346-357 | 12 | |
| β-strand | 362-365 | 4 | 6 |
| α-helix | 368-375 | 8 | |
| β-strand | 378 | 1 | 6 |
| β-strand | 382-388 | 7 | 6 |
| β-strand | 394-402 | 9 | 6 |
| β-strand | 405-407 | 3 | 7 |
| β-strand | 415-416 | 2 | 7 |
| β-strand | 418-421 | 4 | 6 |
| β-strand | 425-426 | 2 | 6 |
| α-helix | 431-444 | 14 | |
| β-strand | 449-453 | 5 | 6 |
| α-helix | 459-462 | 4 | |
| β-strand | 468-469 | 2 | 6 |
| β-strand | 470 | 1 | 8 |
| β-strand | 471-479 | 9 | 6 |
| β-strand | 482 | 1 | 5 |
| α-helix | 488-490 | 3 | |
| β-strand | 491 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glycylpeptide N-tetradecanoyltransferase 1 | A, B | protein | 401 | Homo sapiens | P30419 (AlphaFold model) |
| Myr-gly-asn-cys-phe-ser-lys-pro-arg | E, F | protein | 8 | synthetic construct |
>8Q26_1 Glycylpeptide N-tetradecanoyltransferase 1 (chains A, B) GSEFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQG FTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVR VVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEG IFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKT AGLRPMETKDIPVVHQLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVT DFLSFYTLPSTIMNHPTHKSLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDL MENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ
>8Q26_2 MYR-GLY-ASN-CYS-PHE-SER-LYS-PRO-ARG (chains E, F) GNCFSKPR
Water and common crystallization additives (CL) are not listed.
Novel, tightly structurally related N-myristoyltransferase inhibitors display equally potent yet distinct inhibitory mechanisms. Riviere, F., Dian, C., Dutheil, R.F. et al. Structure (2024) 32:1737-1750.e3. DOI 10.1016/j.str.2024.08.001 · PubMed
Other PDB entries of the same protein (UniProt P30419 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8Q26 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.