8QTC: Arabidopsis thaliana 14-3-3 omega

Crystal structure of Arabidopsis thaliana 14-3-3 omega in complex with a phosphopeptide from the transcription factor BZR1. Determined by X-ray diffraction at 3.5 Å resolution. Released 15 Nov 2023.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Arabidopsis thaliana
Chains: 3
Atoms: 3,801
Mol. weight: 55.44 kDa
Ligands: CO
Released: 15 Nov 2023

Explore 8QTC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QTC contains 26 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-18	15
α-helix	21-34	14
α-helix	39-41	3
α-helix	42-75	34
α-helix	79-106	28
α-helix	107-111	5
α-helix	112-115	4
α-helix	119-138	20
α-helix	141-165	25
α-helix	171-182	12
α-helix	183-187	5
α-helix	191-207	17
α-helix	214-237	24

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-17	14
α-helix	21-34	14
α-helix	39-41	3
α-helix	42-75	34
α-helix	79-106	28
α-helix	107-111	5
α-helix	112-114	3
α-helix	118-138	21
α-helix	141-165	25
α-helix	171-182	12
α-helix	183-187	5
α-helix	191-207	17
α-helix	217-234	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3-like protein GF14 omega	A, B	protein	240	Arabidopsis thaliana	Q01525 (AlphaFold model)
Protein BRASSINAZOLE-RESISTANT 1	C	protein	5	Arabidopsis thaliana

Sequence of entity 1 (A, B), FASTA

>8QTC_1 14-3-3-like protein GF14 omega (chains A, B)
MASGREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEERNLLSVAYKNVIGARR
ASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICDGILKLLDSRLIPAAASGDS
KVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLAAYKSAQDIANAELAPTHPIRLGLALNF
SVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD

Sequence of entity 2 (C), FASTA

>8QTC_2 Protein BRASSINAZOLE-RESISTANT 1 (chains C)
SNSAP

Ligands and cofactors

ID	Name	Formula	Copies
CO	Cobalt (II) ion	Co	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Mechanistic Insights into the Function of 14-3-3 Proteins as Negative Regulators of Brassinosteroid Signaling in Arabidopsis. Obergfell, E., Hohmann, U., Moretti, A. et al. Plant Cell Physiol (2024) 65:1674-1688. DOI 10.1093/pcp/pcae056 · PubMed

Other PDB entries of the same protein (UniProt Q01525 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QTF 1.9 Å, Crystal structure of a C-terminally truncated version of Arabidopsis thaliana 14-3-3…
8QTT 2.35 Å, Crystal structure of a C-terminally truncated version of Arabidopsis thaliana 14-3-3…

Browse structure collections

About this viewer

MolViewer shows 8QTC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.