8QTF: 14-3-3-like protein GF14 omega

Crystal structure of a C-terminally truncated version of Arabidopsis thaliana 14-3-3 omega in complex with a phosphopeptide from the transcription factor BZR1. Determined by X-ray diffraction at 1.9 Å resolution. Released 22 Nov 2023.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Arabidopsis thaliana
Chains: 20
Atoms: 20,174
Mol. weight: 282.35 kDa
Released: 22 Nov 2023

Explore 8QTF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QTF contains 132 α-helices and 0 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	5-17	13
α-helix	21-34	14
α-helix	39-41	3
α-helix	42-75	34
α-helix	79-106	28
α-helix	107-111	5
α-helix	112-114	3
α-helix	118-138	21
α-helix	141-165	25
α-helix	171-182	12
α-helix	183-187	5
α-helix	191-207	17
α-helix	215-235	21

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	4-17	14
α-helix	21-35	15
α-helix	42-76	35
α-helix	79-106	28
α-helix	107-111	5
α-helix	112-114	3
α-helix	118-138	21
α-helix	141-165	25
α-helix	171-182	12
α-helix	183-187	5
α-helix	191-207	17
α-helix	217-235	19

Chain C: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	4-17	14
α-helix	21-34	14
α-helix	38-41	4
α-helix	42-76	35
α-helix	79-106	28
α-helix	107-111	5
α-helix	112-114	3
α-helix	118-138	21
α-helix	141-165	25
α-helix	171-182	12
α-helix	183-187	5
α-helix	191-206	16
α-helix	209-211	3
α-helix	214-234	21

Chain D: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	21-34	14
α-helix	39-41	3
α-helix	42-75	34
α-helix	79-106	28
α-helix	107-111	5
α-helix	112-114	3
α-helix	118-136	19
α-helix	141-165	25
α-helix	171-182	12
α-helix	183-187	5
α-helix	191-208	18
α-helix	209-211	3
α-helix	214-234	21

Chain E: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	21-34	14
α-helix	38-41	4
α-helix	42-76	35
α-helix	79-106	28
α-helix	107-111	5
α-helix	112-114	3
α-helix	118-138	21
α-helix	141-165	25
α-helix	171-182	12
α-helix	183-187	5
α-helix	191-206	16
α-helix	209-211	3
α-helix	214-234	21

Chain F: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	5-17	13
α-helix	21-33	13
α-helix	39-41	3
α-helix	42-76	35
α-helix	79-106	28
α-helix	107-111	5
α-helix	112-114	3
α-helix	118-138	21
α-helix	141-165	25
α-helix	171-182	12
α-helix	183-187	5
α-helix	191-205	15
α-helix	214-235	22

Chain G: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	4-17	14
α-helix	21-34	14
α-helix	39-41	3
α-helix	42-76	35
α-helix	79-106	28
α-helix	107-111	5
α-helix	112-114	3
α-helix	118-138	21
α-helix	141-165	25
α-helix	171-182	12
α-helix	183-187	5
α-helix	191-207	17
α-helix	209-211	3
α-helix	215-234	20

Chain H: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	21-34	14
α-helix	42-76	35
α-helix	79-106	28
α-helix	107-111	5
α-helix	112-114	3
α-helix	118-138	21
α-helix	141-165	25
α-helix	171-182	12
α-helix	183-187	5
α-helix	191-207	17
α-helix	209-211	3
α-helix	214-235	22

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3-like protein GF14 omega	A, B, C, D, E, F, G, H, I, J	protein	242	Arabidopsis thaliana	Q01525 (AlphaFold model)
Protein BRASSINAZOLE-RESISTANT 1	K, L, M, N, O, P, Q, R, S, T	protein	7	Arabidopsis thaliana	Q8S307 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>8QTF_1 14-3-3-like protein GF14 omega (chains A, B, C, D, E, F, G, H, I, J)
GAMASGREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEERNLLSVAYKNVIGA
RRASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICDGILKLLDSRLIPAAASG
DSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTLAAYKSAQDIANAELAPTHPIRLGLAL
NFSVFYYEILNSPDRACNLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDM
QD

Sequence of entity 2 (K, L, M, N, O, P, Q, R, S, T), FASTA

>8QTF_2 Protein BRASSINAZOLE-RESISTANT 1 (chains K, L, M, N, O, P, Q, R, S, T)
RISNSAP

Primary citation

Mechanistic Insights into the Function of 14-3-3 Proteins as Negative Regulators of Brassinosteroid Signaling in Arabidopsis. Obergfell, E., Hohmann, U., Moretti, A. et al. Plant Cell Physiol (2024) 65:1674-1688. DOI 10.1093/pcp/pcae056 · PubMed

Other PDB entries of the same protein (UniProt Q01525 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QTT 2.35 Å, Crystal structure of a C-terminally truncated version of Arabidopsis thaliana 14-3-3…
8QTC 3.5 Å, Crystal structure of Arabidopsis thaliana 14-3-3 omega in complex with a phosphopeptide…

Browse structure collections

About this viewer

MolViewer shows 8QTF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.