8QU9: Ferritin heavy chain

Structure of the NCOA4 (Nuclear Receptor Coactivator 4)-FTH1 (H-Ferritin) complex. Determined by electron microscopy at 2.88 Å resolution. Released 15 May 2024.

Method: Electron microscopy
Resolution: 2.88 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,548
Mol. weight: 22.75 kDa
Ligands: FE
Released: 15 May 2024

Explore 8QU9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QU9 contains 11 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	15-39	25
α-helix	50-76	27
α-helix	87-89	3
α-helix	97-124	28
α-helix	128-134	7
α-helix	135-139	5
α-helix	140-159	20
α-helix	165-170	6
α-helix	171-175	5

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	485-490	6
α-helix	494-496	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferritin heavy chain	A	protein	178	Homo sapiens	P02794 (AlphaFold model)
NCOA4 (Nuclear Receptor Coactivator 4)	B	protein	16	Homo sapiens	Q13772 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8QU9_1 Ferritin heavy chain (chains A)
TSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEERE
HAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDK
NDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES

Sequence of entity 2 (B), FASTA

>8QU9_2 NCOA4 (Nuclear Receptor Coactivator 4) (chains B)
DSFQVIKNSPLSEWLI

Ligands and cofactors

ID	Name	Formula	Copies
FE	FE (III) ion	Fe	2

Primary citation

Structural basis for the intracellular regulation of ferritin degradation. Hoelzgen, F., Nguyen, T.T.P., Klukin, E. et al. Nat Commun (2024) 15:3802-3802. DOI 10.1038/s41467-024-48151-1 · PubMed

Other PDB entries of the same protein (UniProt P02794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B8F 1.06 Å, Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
6B8G 1.13 Å, Twice-Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
7A6A 1.15 Å, 1.15 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
8B7O 1.17 Å, X-ray structure of Auranofin-human H-chain ferritin
6WYF 1.25 Å, Crystal structure of Human H-chain Ferritin variant 157C Delta C-star Modified with a…
6Z6U 1.25 Å, 1.25 A structure of human apoferritin obtained from Titan Mono-BCOR microscope
7RRP 1.27 Å, Apoferritin structure at 1.27 angstrom resolution determined from a 300 kV Titan Krios…
7A6B 1.33 Å, 1.33 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
4Y08 1.34 Å, One minute iron loaded human H ferritin
7K3V 1.34 Å, Apoferritin structure at 1.34 angstrom resolution determined from a 300 kV Titan Krios…
7K3W 1.36 Å, Apoferritin structure at 1.36 angstrom resolution determined from a 300 kV Titan Krios…
9RGH 1.38 Å, X-ray structure of a polyoxidovanadate/human H-ferritin adduct obtained when the protein…

Browse structure collections

About this viewer

MolViewer shows 8QU9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.