8QW4: FZD3

FZD3 in complex with nanobody 9. Determined by electron microscopy at 2.9 Å resolution. Released 4 Sept 2024.

Method: Electron microscopy
Resolution: 2.9 Å
Organisms: Homo sapiens, Lama glama
Chains: 2
Atoms: 3,479
Mol. weight: 74.64 kDa
Released: 4 Sept 2024

Explore 8QW4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QW4 contains 18 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	177-178	2	1
β-strand	184-185	2	1
α-helix	196-224	29
α-helix	237-252	16
α-helix	253-255	3
α-helix	284-312	29
α-helix	321-325	5
α-helix	328-344	17
α-helix	368-371	4
α-helix	372-376	5
α-helix	377-401	25
α-helix	408-410	3
α-helix	414-442	29
α-helix	446-451	6
α-helix	453-456	4
α-helix	475-478	4
α-helix	480-488	9
α-helix	489-494	6
α-helix	495-498	4

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	2
β-strand	22-27	6	2
β-strand	36-41	6	3
β-strand	49-54	6	3
β-strand	61-62	2	3
β-strand	71-74	4	2
β-strand	79-84	6	2
α-helix	90-92	3
β-strand	94-95	2	4
β-strand	97-102	6	3
β-strand	107-110	4	3
β-strand	115-116	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Frizzled-3	A	protein	525	Homo sapiens	Q9NPG1 (AlphaFold model)
Nanobody Nb9	B	protein	125	Lama glama

Sequence of entity 1 (A), FASTA

>8QW4_1 Frizzled-3 (chains A)
MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKGTLEVLFQ

Sequence of entity 2 (B), FASTA

>8QW4_2 Nanobody Nb9 (chains B)
QVQLVESGGGLVQSGDSLRLSCTASGRIFNLDVMGWYRQAPGKRRELVADITSGGKINYA
DSVKGRFTISRDNTKDTVYLQMNSLKPEDTAVYYCNAEVEWLDMDYWGKGTQVTVSSHHH
HHHHH

Primary citation

Structural insights into Frizzled3 through nanobody modulators. Hillier, J., Zhao, Y., Carrique, L. et al. Nat Commun (2024) 15:7228-7228. DOI 10.1038/s41467-024-51451-1 · PubMed

Other PDB entries of the same protein (UniProt Q9NPG1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q7O 1.76 Å, Crystal structure of the FZD3 cysteine-rich domain in complex with a nanobody (14478)
8JHI 3.2 Å, FZD3-Gs complex
8JHC 3.3 Å, FZD3 in inactive state

Browse structure collections

About this viewer

MolViewer shows 8QW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.