8QZZ: Human eIF2 alpha-gamma

Crystal structure of human eIF2 alpha-gamma complexed with PPP1R15A_420-452. Determined by X-ray diffraction at 3.35 Å resolution. Released 20 Mar 2024.

Method: X-ray diffraction
Resolution: 3.35 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,213
Mol. weight: 91.55 kDa
Ligands: GNP
Released: 20 Mar 2024

Explore 8QZZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QZZ contains 20 α-helices and 34 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	25-27	3
α-helix	33-36	4
β-strand	42-47	6	1
α-helix	54-62	9
β-strand	82-91	10	1
α-helix	96-97	2
β-strand	102-105	4	1
β-strand	112-114	3	1
β-strand	123-134	12	1
α-helix	142-147	6
β-strand	154-160	7	1
α-helix	168-180	13
β-strand	185-190	6	1
α-helix	197-211	15
β-strand	221-223	3	1
β-strand	225	1	2
β-strand	230	1	2
α-helix	232-241	10
α-helix	244-247	4
α-helix	253-254	2
β-strand	255-263	9	3
β-strand	270	1	4
α-helix	271-273	3
β-strand	277-285	9	3
β-strand	288-289	2	5
β-strand	293-303	11	3
β-strand	309-323	15	3
β-strand	326-328	3	3
β-strand	330-331	2	5
β-strand	337-341	5	3
α-helix	345-348	4
α-helix	349-351	3
β-strand	357-360	4	3
α-helix	365-366	2
β-strand	367-377	11	6
β-strand	378	1	7
β-strand	403-408	6	6
β-strand	411-420	10	6
β-strand	424-434	11	6
β-strand	440-445	6	6
α-helix	447-449	3
β-strand	452-465	14	6
α-helix	466-467	2

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	189-198	10	4
α-helix	204-217	14
β-strand	220	1	8
β-strand	223	1	8
β-strand	225-231	7	4
β-strand	234-241	8	4
α-helix	244-264	21
β-strand	268-277	10	4
α-helix	280-295	16

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	427-432	6
β-strand	433	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 2 subunit 3	A	protein	472	Homo sapiens	P41091 (AlphaFold model)
Eukaryotic translation initiation factor 2 subunit 1	B	protein	315	Homo sapiens	P05198 (AlphaFold model)
Protein phosphatase 1 regulatory subunit 15A	C	protein	33	Homo sapiens	O75807 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8QZZ_1 Eukaryotic translation initiation factor 2 subunit 3 (chains A)
MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD

Sequence of entity 2 (B), FASTA

>8QZZ_2 Eukaryotic translation initiation factor 2 subunit 1 (chains B)
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED

Sequence of entity 3 (C), FASTA

>8QZZ_3 Protein phosphatase 1 regulatory subunit 15A (chains C)
ASTPPASAFLKAWVYRPGEDTEEEEDEDVDSED

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1

Primary citation

Substrate recruitment via eIF2 gamma enhances catalytic efficiency of a holophosphatase that terminates the integrated stress response. Yan, Y., Shetty, M., Harding, H.P. et al. Proc Natl Acad Sci U S A (2024) 121:e2320013121-e2320013121. DOI 10.1073/pnas.2320013121 · PubMed

Other PDB entries of the same protein (UniProt P41091 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PHV 1.97 Å, Structure of Human selenomethionylated Cdc123 bound to domain 3 of eIF2 gamma
8PHD 2.08 Å, Structure of Human Cdc123 bound to domain 3 of eIF2 gamma and ATP
8PPL 2.65 Å, MERS-CoV Nsp1 bound to the human 43S pre-initiation complex
9HVE 2.7 Å, Native human eIF2-eIF2B complex
7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
28ZX 2.8 Å, human 48S PIC with mRNA (Kozak_1)
28ZV 2.9 Å, human 48S PIC with mRNA (non-Kozak)
6ZP4 2.9 Å, SARS-CoV-2 Nsp1 bound to a human 43S preinitiation ribosome complex - state 2
28ZY 3.0 Å, human 48S PIC with mRNA (Kozak_2)
6O85 3.03 Å, Electron cryo-microscopy of the eukaryotic translation initiation factor 2B bound to…
28ZU 3.2 Å, human 48S PIC with Kozak mRNA and eIF1A W70A mutant
8PJ4 3.2 Å, Structure of human 48S translation initiation complex after eIF5 release (48S-4)

Browse structure collections

About this viewer

MolViewer shows 8QZZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.