9HVE: Native human eIF2-eIF2B complex

Native human eIF2-eIF2B complex. Determined by electron microscopy at 2.7 Å resolution. Released 19 Nov 2025.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 16
Atoms: 44,088
Mol. weight: 775.04 kDa
Ligands: GTP
Released: 19 Nov 2025

Explore 9HVE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9HVE contains 250 α-helices and 316 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-16	14
α-helix	22-36	15
α-helix	42-59	18
α-helix	63-82	20
α-helix	86-104	19
α-helix	107-115	9
α-helix	116-118	3
β-strand	123-127	5	40
α-helix	132-143	12
β-strand	148-153	6	40
α-helix	160-170	11
β-strand	175-178	4	40
α-helix	183-186	4
β-strand	192-195	4	40
β-strand	200	1	41
β-strand	206-209	4	41
α-helix	212-221	10
β-strand	226-229	4	40
α-helix	232-234	3
β-strand	235	1	41
α-helix	243-245	3
α-helix	248-251	4
β-strand	264	1	42
β-strand	273-276	4	41
α-helix	278-280	3
β-strand	283-286	4	40
β-strand	289-291	3	40
α-helix	293-301	9

Chain B: 17 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	3-16	14
α-helix	22-36	15
α-helix	42-59	18
α-helix	63-82	20
α-helix	86-104	19
α-helix	107-115	9
α-helix	116-118	3
β-strand	123-127	5	42
α-helix	132-143	12
β-strand	148-153	6	42
α-helix	160-170	11
β-strand	175-178	4	42
α-helix	183-186	4
β-strand	192-195	4	42
β-strand	200	1	64
β-strand	206-209	4	64
α-helix	212-221	10
β-strand	226-229	4	42
α-helix	232-234	3
β-strand	235	1	64
α-helix	243-245	3
α-helix	248-251	4
β-strand	264	1	40
α-helix	267-269	3
β-strand	273-276	4	64
α-helix	278-280	3
β-strand	283-286	4	42
β-strand	289-291	3	42
α-helix	293-303	11

Chain C: 19 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	7-23	17
α-helix	31-48	18
α-helix	54-71	18
α-helix	76-96	21
α-helix	110-114	5
α-helix	129-152	24
α-helix	155-157	3
β-strand	163-168	6	46
α-helix	172-182	11
β-strand	187-192	6	46
α-helix	199-209	11
β-strand	213-217	5	46
α-helix	219-221	3
α-helix	222-226	5
β-strand	231-234	4	46
β-strand	238-239	2	62
β-strand	245-248	4	62
α-helix	251-260	10
β-strand	265-268	4	46
α-helix	271-273	3
β-strand	274	1	62
β-strand	288	1	63
α-helix	297-299	3
α-helix	301-304	4
β-strand	306-308	3	44
β-strand	311	1	63
β-strand	313-316	4	62
α-helix	318-320	3
β-strand	323-326	4	46
β-strand	329-331	3	46
α-helix	333-335	3
α-helix	336-341	6
α-helix	346-348	3

Chain D: 19 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	7-24	18
α-helix	31-48	18
α-helix	54-71	18
α-helix	76-96	21
α-helix	110-114	5
α-helix	129-152	24
α-helix	155-157	3
β-strand	163-168	6	36
α-helix	172-182	11
β-strand	187-192	6	36
α-helix	199-209	11
β-strand	213-217	5	36
α-helix	219-221	3
α-helix	222-226	5
β-strand	231-234	4	36
β-strand	238-239	2	37
β-strand	245-248	4	37
α-helix	251-260	10
β-strand	265-268	4	36
α-helix	271-273	3
β-strand	274	1	37
β-strand	288	1	38
α-helix	297-299	3
α-helix	301-304	4
β-strand	306-308	3	39
β-strand	311	1	38
β-strand	313-316	4	37
α-helix	318-320	3
β-strand	323-326	4	36
β-strand	329-331	3	36
α-helix	333-335	3
α-helix	336-341	6
α-helix	346-348	3

Chain E: 13 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	11
α-helix	14-16	3
α-helix	25-27	3
β-strand	29-30	2	12
β-strand	33-34	2	12
α-helix	37-46	10
β-strand	50-55	6	11
α-helix	57-63	7
β-strand	72-73	2	11
β-strand	76-77	2	11
α-helix	86-93	8
α-helix	94-96	3
β-strand	100-105	6	11
β-strand	108-110	3	13
α-helix	115-123	9
β-strand	128-133	6	11
β-strand	142	1	14
β-strand	145	1	14
β-strand	156-160	5	15
β-strand	166	1	11
β-strand	167-172	6	15
β-strand	179-182	4	16
α-helix	185-189	5
β-strand	192-193	2	17
β-strand	194-196	3	15
β-strand	200-201	2	11
β-strand	206-207	2	11
α-helix	209-217	9
α-helix	224-228	5
α-helix	229-236	8
α-helix	263-266	4
β-strand	300-305	6	11
β-strand	310-312	3	13
α-helix	316-333	18
β-strand	340	1	18
β-strand	344-346	3	19
β-strand	357-358	2	18
β-strand	361-364	4	19
β-strand	368-371	4	20
β-strand	374-375	2	18
β-strand	380-381	2	19
β-strand	385-388	4	20
β-strand	391-392	2	18
β-strand	397-398	2	19
β-strand	403-405	3	20
β-strand	408-409	2	18
β-strand	414-415	2	19
β-strand	420-422	3	20
β-strand	425-426	2	18
β-strand	431-432	2	19
β-strand	438-439	2	20
β-strand	443	1	18

Chain F: 15 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	1
β-strand	15	1	2
α-helix	25-27	3
β-strand	29-30	2	3
β-strand	33-34	2	3
α-helix	37-46	10
β-strand	50-55	6	1
α-helix	57-64	8
β-strand	72-77	6	1
α-helix	86-93	8
α-helix	94-96	3
β-strand	100-105	6	1
β-strand	108-110	3	4
α-helix	115-123	9
β-strand	128-133	6	1
α-helix	141-142	2
β-strand	156-160	5	5
β-strand	166	1	1
β-strand	167-172	6	5
α-helix	173-175	3
β-strand	179-182	4	6
α-helix	185-189	5
β-strand	192-193	2	7
β-strand	194-196	3	5
α-helix	199	1
β-strand	200-201	2	1
β-strand	205-207	3	1
α-helix	209-217	9
α-helix	224-228	5
α-helix	229-236	8
α-helix	263-266	4
β-strand	300-305	6	1
β-strand	310-312	3	4
β-strand	315	1	2
α-helix	316-333	18
β-strand	340	1	8
β-strand	344-346	3	9
β-strand	352	1	10
β-strand	357-358	2	8
β-strand	361-364	4	9
β-strand	369-371	3	10
β-strand	374-375	2	8
β-strand	380-381	2	9
β-strand	386-388	3	10
β-strand	391-392	2	8
β-strand	397-398	2	9
β-strand	403-405	3	10
β-strand	408-409	2	8
β-strand	414-415	2	9
β-strand	420-422	3	10
β-strand	425-426	2	8
β-strand	431-432	2	9
β-strand	438-439	2	10
β-strand	442-443	2	8

Chains G and H: 22 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	167-172	6
α-helix	178-180	3
β-strand	185	1	65
α-helix	192-195	4
α-helix	205-215	11
α-helix	222-238	17
α-helix	248-266	19
α-helix	268-270	3
α-helix	271-285	15
α-helix	293-308	16
α-helix	309-313	5
α-helix	314-326	13
β-strand	331-336	6	39
α-helix	340-351	12
β-strand	356-362	7	39
α-helix	369-378	10
β-strand	383-387	5	39
α-helix	388-390	3
α-helix	391-394	4
β-strand	400-404	5	39
β-strand	407-408	2	66
β-strand	414-417	4	66
α-helix	420-429	10
β-strand	434-437	4	39
α-helix	440-442	3
β-strand	443	1	66
β-strand	457	1	65
α-helix	460-463	4
α-helix	476-478	3
β-strand	482-484	3	36
β-strand	487	1	65
β-strand	489-492	4	66
α-helix	494-496	3
β-strand	499-502	4	39
β-strand	505-507	3	39
α-helix	509-511	3
α-helix	512-521	10

Chain I: 28 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	39-43	5
β-strand	44-48	5	7
α-helix	59-61	3
α-helix	65-67	3
β-strand	69-70	2	23
β-strand	73-74	2	23
α-helix	75-86	12
β-strand	90-95	6	7
α-helix	99-107	9
α-helix	110-112	3
β-strand	119-124	6	7
α-helix	131-141	11
β-strand	148-152	5	7
β-strand	155-157	3	24
α-helix	162-174	13
β-strand	179-187	9	7
β-strand	201-206	6	7
β-strand	211-217	7	7
β-strand	224-227	4	6
α-helix	228-231	4
β-strand	240-241	2	7
β-strand	244-252	9	7
α-helix	254-262	9
α-helix	269-278	10
β-strand	286-292	7	7
β-strand	297-299	3	24
α-helix	303-314	12
β-strand	336-338	3	25
α-helix	339-341	3
β-strand	342-344	3	25
β-strand	349-350	2	26
β-strand	355-356	2	27
β-strand	360-362	3	25
β-strand	367-368	2	26
β-strand	373-375	3	27
β-strand	378-379	2	25
β-strand	384-385	2	26
β-strand	390-392	3	27
β-strand	395-396	2	25
β-strand	401-402	2	26
β-strand	407-409	3	27
β-strand	412-413	2	25
β-strand	418-419	2	26
β-strand	423-425	3	27
β-strand	430-431	2	25
β-strand	436-437	2	26
β-strand	441-443	3	27
β-strand	448-450	3	25
α-helix	456-460	5
α-helix	480-482	3
α-helix	485-488	4
β-strand	493	1	26
β-strand	495-496	2	25
α-helix	499-502	4
α-helix	550-567	18
α-helix	571-585	15
α-helix	589-606	18
α-helix	614-627	14
α-helix	629-635	7
α-helix	641-655	15
α-helix	657-662	6
α-helix	663-672	10
α-helix	678-684	7
α-helix	692-696	5
α-helix	701-716	16

7 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Translation initiation factor eIF-2B subunit gamma	E, F	protein	452	Homo sapiens	Q9NR50 (AlphaFold model)
Eukaryotic translation initiation factor 2 subunit 1	K, L	protein	315	Homo sapiens	P05198 (AlphaFold model)
Translation initiation factor eIF2B subunit epsilon	I, J	protein	721	Homo sapiens	Q13144 (AlphaFold model)
Eukaryotic translation initiation factor 2 subunit 3	O, P	protein	472	Homo sapiens	P41091 (AlphaFold model)
Translation initiation factor eIF2B subunit beta	C, D	protein	351	Homo sapiens	P49770
Translation initiation factor eIF-2B subunit alpha	A, B	protein	305	Homo sapiens	Q14232
Translation initiation factor eIF-2B subunit delta	G, H	protein	523	Homo sapiens	Q9UI10
Eukaryotic translation initiation factor 2 subunit 2	M, N	protein	333	Homo sapiens	P20042

Sequence of entity 1 (E, F), FASTA

>9HVE_1 Translation initiation factor eIF-2B subunit gamma (chains E, F)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI

Sequence of entity 2 (K, L), FASTA

>9HVE_2 Eukaryotic translation initiation factor 2 subunit 1 (chains K, L)
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED

Sequence of entity 3 (I, J), FASTA

>9HVE_3 Translation initiation factor eIF2B subunit epsilon (chains I, J)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D

Sequence of entity 4 (O, P), FASTA

>9HVE_4 Eukaryotic translation initiation factor 2 subunit 3 (chains O, P)
MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD

Sequence of entity 5 (C, D), FASTA

>9HVE_5 Translation initiation factor eIF2B subunit beta (chains C, D)
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL

Sequence of entity 6 (A, B), FASTA

>9HVE_6 Translation initiation factor eIF-2B subunit alpha (chains A, B)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL

Sequence of entity 7 (G, H), FASTA

>9HVE_7 Translation initiation factor eIF-2B subunit delta (chains G, H)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ

Sequence of entity 8 (M, N), FASTA

>9HVE_8 Eukaryotic translation initiation factor 2 subunit 2 (chains M, N)
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEED
TRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIM
LGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELL
NRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFL
LAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	2

Primary citation

Termination of the integrated stress response. De Miguel, C., Thorkelsson, S.R., Fatalska, A. et al. Science (2026) 391:eadw5137-eadw5137. DOI 10.1126/science.adw5137 · PubMed

Other PDB entries of the same protein (UniProt Q9NR50 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7F64 2.42 Å, eIF2B-SFSV NSs
9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
9Y5T 2.78 Å, eIF2B lacking the latch helix bound to ISRACT-02 (Active state)
6CAJ 2.8 Å, Electron cryo-microscopy of the eukaryotic translation initiation factor 2B from Homo…
7L70 2.8 Å, The eukaryotic translation initiation factor 2B from Homo sapiens in its apo form
7TRJ 2.8 Å, The eukaryotic translation initiation factor 2B from Homo sapiens with a H160D mutation…

Browse structure collections

About this viewer

MolViewer shows 9HVE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.