8R22: INTS9-INTS11-BRAT1-WDR73 complex

INTS9-INTS11-BRAT1-WDR73 complex. Determined by electron microscopy at 3.9 Å resolution. Released 31 Jul 2024.

Method: Electron microscopy
Resolution: 3.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 15,069
Mol. weight: 274.11 kDa
Ligands: ZN
Released: 31 Jul 2024

Explore 8R22 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8R22 contains 88 α-helices and 94 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 46 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	9-17	9
α-helix	22-24	3
α-helix	27-39	13
α-helix	46-51	6
α-helix	55-61	7
α-helix	73-83	11
α-helix	87-92	6
α-helix	99-103	5
α-helix	108-110	3
α-helix	117-130	14
α-helix	134-139	6
α-helix	140-144	5
α-helix	146-152	7
α-helix	158-175	18
α-helix	193-205	13
α-helix	211-224	14
α-helix	231-247	17
α-helix	258-267	10
α-helix	270-273	4
α-helix	279-289	11
α-helix	295-303	9
α-helix	310-329	20
β-strand	331	1	1
α-helix	349-356	8
α-helix	358-375	18
α-helix	388-402	15
β-strand	407	1	1
α-helix	410-418	9
α-helix	424-435	12
α-helix	443-457	15
α-helix	464-478	15
α-helix	494-508	15
α-helix	514-530	17
α-helix	535-543	9
α-helix	546-552	7
α-helix	553-555	3
α-helix	559-575	17
α-helix	590-601	12
α-helix	607-621	15
α-helix	631-642	12
α-helix	650-665	16
α-helix	688-697	10
α-helix	700-708	9
α-helix	713-733	21
α-helix	769-778	10
α-helix	781-788	8
α-helix	799-808	10

Chain B: 18 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	2
β-strand	15-18	4	2
β-strand	23-26	4	2
β-strand	31	1	3
α-helix	32-37	6
β-strand	70-71	2	4
β-strand	74-75	2	4
β-strand	83-84	2	3
β-strand	98-99	2	2
α-helix	104-106	3
α-helix	110-115	6
β-strand	122-125	4	2
α-helix	127-145	19
α-helix	159-163	5
α-helix	166	1
β-strand	178-179	2	3
α-helix	184-192	9
β-strand	194-196	3	2
β-strand	203	1	5
β-strand	211-214	4	5
β-strand	224-227	4	5
β-strand	234-238	5	5
α-helix	248-250	3
β-strand	260-264	5	5
β-strand	266	1	6
α-helix	274-289	16
β-strand	295-298	4	7
α-helix	304-318	15
β-strand	326-329	4	7
α-helix	333-341	9
β-strand	373-376	4	7
α-helix	383-386	4
β-strand	392-395	4	7
α-helix	404-412	9
β-strand	419-420	2	7
β-strand	422	1	8
α-helix	429-433	5
α-helix	434-436	3
β-strand	442	1	7
β-strand	445	1	8
β-strand	452	1	6
α-helix	454-464	11
β-strand	468-471	4	5
α-helix	473-475	3
α-helix	495-496	2
β-strand	497-498	2	5
β-strand	504-506	3	2

Chain C: 16 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	9
β-strand	20-24	5	9
β-strand	27-31	5	9
α-helix	48-50	3
α-helix	57-60	4
β-strand	61-65	5	9
α-helix	77-78	2
α-helix	79-83	5
β-strand	90-91	2	9
β-strand	93	1	10
α-helix	94-113	20
α-helix	123-130	8
β-strand	133	1	9
β-strand	136	1	10
β-strand	141-144	4	11
β-strand	148-151	4	11
β-strand	154	1	12
β-strand	163-167	5	11
β-strand	172-176	5	11
β-strand	191	1	12
β-strand	201-204	4	11
β-strand	209-210	2	13
α-helix	211	1
β-strand	212	1	14
α-helix	213	1
α-helix	214-231	18
β-strand	235-238	4	15
α-helix	244-259	16
β-strand	265-267	3	15
α-helix	275-280	6
β-strand	305-306	2	15
β-strand	320-323	4	15
α-helix	332-339	8
β-strand	347-350	4	15
α-helix	354-355	2
α-helix	359-363	5
β-strand	369-370	2	16
β-strand	378-379	2	16
β-strand	383-386	4	15
α-helix	395-405	11
β-strand	410	1	17
β-strand	411-415	5	11
α-helix	420-431	12
β-strand	435	1	17
β-strand	444-447	4	9

Chain D: 8 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	3-14	12
β-strand	15-22	8	14
β-strand	27	1	18
β-strand	31-34	4	13
β-strand	37-40	4	13
β-strand	42	1	18
β-strand	49-55	7	13
α-helix	56-57	2
β-strand	74-82	9	13
β-strand	85-89	5	19
β-strand	97-99	3	20
β-strand	100-103	4	19
β-strand	107-113	7	20
α-helix	114	1
β-strand	119	1	13
β-strand	120-127	8	20
α-helix	136-137	2
β-strand	138-140	3	21
β-strand	148-152	5	21
β-strand	154	1	22
α-helix	155-157	3
β-strand	159-162	4	21
β-strand	168-171	4	21
β-strand	179	1	22
β-strand	182-187	6	23
β-strand	190-194	5	23
β-strand	200-204	5	23
β-strand	212	1	23
β-strand	227-230	4	24
β-strand	241-244	4	24
β-strand	249-253	5	24
β-strand	261-266	6	24
α-helix	276-278	3
β-strand	280-283	4	25
β-strand	290-294	5	25
β-strand	300-304	5	25
α-helix	306-308	3
β-strand	325-327	3	25
α-helix	329-331	3
β-strand	344-349	6	14
β-strand	356-361	6	14
β-strand	365-371	7	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRCA1-associated ATM activator 1	A	protein	827	Homo sapiens	Q6PJG6 (AlphaFold model)
Integrator complex subunit 9	B	protein	658	Homo sapiens	Q9NV88 (AlphaFold model)
Integrator complex subunit 11	C	protein	612	Homo sapiens	Q5TA45 (AlphaFold model)
WD repeat-containing protein 73	D	protein	385	Homo sapiens	Q6P4I2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8R22_1 BRCA1-associated ATM activator 1 (chains A)
GPSQSNMDPECAQLLPALCAVLVDPRQPVADDTCLEKLLDWFKTVTEGESSVVLLQEHPC
LVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPGPLGRATW
AVPTVRSGWIQGLRSLAQHPSALRFLADHGAVDTIFSLQGDSSLFVASAASQLLVHVLAL
SMRGGAEGQPCLPGGDWPACAQKIMDHVEESLCSAATPKVTQALNVLTTTFGRCQSPWTE
ALWVRLSPRVACLLERDPIPAAHSFVDLLLCVARSPVFSSSDGSLWETVARALSCLGPTH
MGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQAPGPPGLLDGTADDATTVDTL
LASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQASLLGATVTVLRLCDGSAAPASSVGGH
LCGTLAGCVRVQRAALDFLGTLSQGTGPQELVTQALAVLLECLESPGSSPTVLKKAFQAT
LRWLLSSPKTPGCSDLGPLIPQFLRELFPVLQKRLCHPCWEVRDSALEFLTQLSRHWGGQ
ADFRCALLASEVPQLALQLLQDPESYVRASAVTAMGQLSSQGLHAPTSPEHAEARQSLFL
ELLHILSVDSEGFPRRAVMQVFTEWLRDGHADAAQDTEQFVATVLQAASRDLDWEVRAQG
LELALVFLGQTLGPPRTHCPYAVALPEVAPAQPLTEALRALCHVGLFDFAFCALFDCDRP
VAQKSCDLLLFLRDKIASYSSLREARGSPNTASAEATLPRWRAGEQAQPPGDQEPEAVLA
MLRSLDLEGLRSTLAESSDHVEKSPQSLLQDMLATGGFLQGDEADCY

Sequence of entity 2 (B), FASTA

>8R22_2 Integrator complex subunit 9 (chains B)
MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDG
NAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFT
GTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRR
CYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGS
SLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCY
PSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEP
PFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTV
IFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPP
AQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATV
SAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEK
HGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF

Sequence of entity 3 (C), FASTA

>8R22_3 Integrator complex subunit 11 (chains C)
GPSDPGPKRAEFMPEIRVTPLGAGQDVGRSCILVSIAGKNVMLDCGMHMGFNDDRRFPDF
SYITQNGRLTDFLDCVIISHFHLDHCGALPYFSEMVGYDGPIYMTHPTQAICPILLEDYR
KIAVDKKGEANFFTSQMIKDCMKKVVAVHLHQTVQVDDELEIKAYYAGHVLGAAMFQIKV
GSESVVYTGDYNMTPDRHLGAAWIDKCRPNLLITESTYATTIRDSKRCRERDFLKKVHET
VERGGKVLIPVFALGRAQELCILLETFWERMNLKVPIYFSTGLTEKANHYYKLFIPWTNQ
KIRKTFVQRNMFEFKHIKAFDRAFADNPGPMVVFATPGMLHAGQSLQIFRKWAGNEKNMV
IMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPE
SVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQG
LLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETAL
RVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGSFLT
SLLKKGLPQAPS

Sequence of entity 4 (D), FASTA

>8R22_4 WD repeat-containing protein 73 (chains D)
GPSQSNSMDPGDDWLVESLRLYQDFYAFDLSGATRVLEWIDDKGVFVAGYESLKKNEILH
LKLPLRLSVKENKGLFPERDFKVRHGGFSDRSIFDLKHVPHTRLLVTSGLPGCYLQVWQV
AEDSDVIKAVSTIAVHEKEESLWPRVAVFSTLAPGVLHGARLRSLQVVDLESRKTTYTSD
VSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKWAPLENRSPGPGSGGERWCAEVGSW
GQGPGPSIASLGSDGRLCLLDPRDLCHPVSSVQCPVSVPSPDPELLRVTWAPGLKNCLAI
SGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCR
PRTLLSATNDASLHVWDWVDLCAPR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Assembly mechanism of Integrator's RNA cleavage module. Sabath, K., Qiu, C., Jonas, S. Mol Cell (2024) 84:2882-2899.e10. DOI 10.1016/j.molcel.2024.06.032 · PubMed

Other PDB entries of the same protein (UniProt Q6PJG6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4IFI 2.2 Å, Structure of human BRCA1 BRCT in complex with BAAT peptide
8R23 3.2 Å, INTS9-INTS11-BRAT1 complex
8UIB 3.21 Å, Structure of the human INTS9-INTS11-BRAT1 complex
8R2D 3.9 Å, Integrator cleavage module assembly intermediate

Browse structure collections

About this viewer

MolViewer shows 8R22 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.