8RBG: Primed myosin-5a

CryoEM structure of primed myosin-5a (ADP-Pi state). Determined by electron microscopy at 4.9 Å resolution. Released 11 Dec 2024.

Method: Electron microscopy
Resolution: 4.9 Å
Organism: Mus musculus
Chains: 1
Atoms: 6,008
Mol. weight: 92.79 kDa
Ligands: ADP, MG, PO4
Released: 11 Dec 2024

Explore 8RBG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8RBG contains 41 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 41 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	12-17	6	1
β-strand	21-27	7	1
β-strand	37-42	6	1
β-strand	47-51	5	1
α-helix	52-53	2
α-helix	58-60	3
β-strand	61-62	2	1
α-helix	63-65	3
α-helix	66-68	3
β-strand	73	1	2
α-helix	74-76	3
α-helix	82-94	13
β-strand	100-103	4	2
β-strand	106-110	5	2
α-helix	121-127	7
α-helix	130-131	2
β-strand	132	1	3
β-strand	135	1	3
α-helix	139-153	15
β-strand	157-162	6	2
β-strand	164	1	4
α-helix	169-184	16
α-helix	191-207	17
β-strand	208-209	2	5
β-strand	217-218	2	5
β-strand	221-228	8	2
β-strand	234-242	9	2
α-helix	247-250	4
α-helix	260-267	8
α-helix	272-277	6
α-helix	282-284	3
α-helix	286-289	4
α-helix	301-315	15
α-helix	319-336	18
β-strand	341-343	3	6
β-strand	347-349	3	6
α-helix	355-364	10
α-helix	368-376	9
β-strand	377-381	5	7
β-strand	386-390	5	7
α-helix	393-423	31
β-strand	431-437	7	2
α-helix	439-440	2
β-strand	441	1	4
α-helix	449-466	18
α-helix	467-472	6
α-helix	473-480	8
α-helix	493-500	8
α-helix	505-514	10
α-helix	520-531	12
β-strand	538-539	2	8
β-strand	547-551	5	8
β-strand	556-560	5	8
α-helix	564-569	6
α-helix	574-581	8
α-helix	587-592	6
α-helix	635-652	18
β-strand	654-661	8	2
α-helix	674-684	11
α-helix	686-695	10
β-strand	699-702	4	9
α-helix	703-710	8
α-helix	711-713	3
α-helix	716-718	3
α-helix	723-734	12
α-helix	738-740	3
β-strand	741-743	3	9
β-strand	747-750	4	9
α-helix	754-777	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-Va	A	protein	801	Mus musculus	Q99104 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8RBG_1 Unconventional myosin-Va (chains A)
MAASELYTKFARVWIPDPEEVWKSAELLKDYKPGDKVLLLHLEEGKDLEYRLDPKTGELP
HLRNPDILVGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYG
EDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNASRFGKYIEIGFDKRYRIIGANMR
TYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLGNADSFHYTKQGGSPMIEGVD
DAKEMAHTRQACTLLGISESYQMGIFRILAGILHLGNVGFASRDSDSCTIPPKHEPLTIF
CDLMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDHVN
QALHSAVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE
QIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEK
PRMSNKAFIIKHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQAISPTSA
TSSGRTPLTRVPVKPTKGRPGQTAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPN
DFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLGDRK
QTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRK
RYLCMQRAAITVQDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	1
PO4	Phosphate ion	O4 P	1

Primary citation

Swinging lever mechanism of myosin directly shown by time-resolved cryo-EM. Klebl, D.P., McMillan, S.N., Risi, C. et al. Nature (2025) 642:519-526. DOI 10.1038/s41586-025-08876-5 · PubMed

Other PDB entries of the same protein (UniProt Q99104 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KU0 1.6 Å, Crystal structure of MyoVa-GTD in complex with MICAL1-GTBM
4KP3 2.4 Å, Crystal Structure of MyoVa-GTD in Complex with Two Cargos
3WB8 2.5 Å, Crystal Structure of MyoVa-GTD
2IX7 2.5 Å, Structure of apo-calmodulin bound to unconventional myosin V
4ZLK 2.5 Å, Crystal structure of mouse myosin-5a in complex with calcium-bound calmodulin
8RBF 4.2 Å, CryoEM structure of the post-powerstroke actomyosin-5a complex
8R9V 4.4 Å, CryoEM structure of the primed actomyosin-5a complex
7YV9 4.78 Å, Cryo-EM structure of full-length Myosin Va in the autoinhibited state
8OF8 7.5 Å, Cryo-EM structure of actomyosin-5a-S1 with the full-length lever (nucleotide free)

Browse structure collections

About this viewer

MolViewer shows 8RBG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.