8ROI: Structural maintenance of chromosomes protein 3

Human cohesin SMC3-HD(EQ)/RAD21-N complex - ADP-bound conformation. Determined by X-ray diffraction at 2.45 Å resolution. Released 11 Sept 2024.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,055
Mol. weight: 65.44 kDa
Ligands: ADP
Released: 11 Sept 2024

Explore 8ROI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ROI contains 20 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	1
β-strand	11	1	2
β-strand	14	1	2
β-strand	18-19	2	1
α-helix	20-24	5
β-strand	27-32	6	3
α-helix	38-49	12
α-helix	51-53	3
α-helix	58-63	6
β-strand	65	1	2
α-helix	72-73	2
β-strand	75-83	9	1
β-strand	95-103	9	1
β-strand	106-111	6	1
β-strand	114-116	3	1
α-helix	118-127	10
β-strand	138-140	3	3
α-helix	141-148	8
α-helix	152-163	12
α-helix	165-212	48
α-helix	984-988	5
α-helix	990-1047	58
β-strand	1052-1057	6	4
β-strand	1096-1101	6	4
α-helix	1117-1134	18
β-strand	1139-1143	5	3
α-helix	1151-1164	14
β-strand	1169-1173	5	3
α-helix	1178-1182	5
β-strand	1185-1192	8	3
β-strand	1195-1201	7	3
α-helix	1203-1206	4

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	14-22	9
α-helix	24-26	3
α-helix	29-34	6
α-helix	37-45	9
α-helix	53-89	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Structural maintenance of chromosomes protein 3	A	protein	462	Homo sapiens	Q9UQE7 (AlphaFold model)
Double-strand-break repair protein rad21 homolog	B	protein	110	Homo sapiens	O60216 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8ROI_1 Structural maintenance of chromosomes protein 3 (chains A)
MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQ
RLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKND
VMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMK
ETEGKREKINELLKYIEERLHTLEEEKEELAGSGSLVPRGSGSYSHVNKKALDQFVNFSE
QKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATL
VMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQL
SGGQKSLVALALIFAIQKCDPAPFYLFDQIDQALDAQHRKAVSDMIMELAVHAQFITTTF
RPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG

Sequence of entity 2 (B), FASTA

>8ROI_2 Double-strand-break repair protein rad21 homolog (chains B)
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREGSLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Primary citation

The cohesin ATPase cycle is mediated by specific conformational dynamics and interface plasticity of SMC1A and SMC3 ATPase domains. Vitoria Gomes, M., Landwerlin, P., Diebold-Durand, M.L. et al. Cell Rep (2024) 43:114656-114656. DOI 10.1016/j.celrep.2024.114656 · PubMed

Other PDB entries of the same protein (UniProt Q9UQE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ROK 2.25 Å, Human cohesin SMC3-HD(EQ)/RAD21-N complex - ATP-Mg-bound conformation - Form 1
6WG4 2.31 Å, Crystal structure of human SMC1-SMC3 hinge domain heterodimer in south-open conformation
8ROH 2.6 Å, Human cohesin SMC3-HD(EQ)/RAD21-N complex - Apo conformation
8ROJ 3.0 Å, Human cohesin SMC3-HD/RAD21-N complex - ADP-Mg-bound conformation
8ROL 3.11 Å, Human cohesin SMC3-HD(EQ)/RAD21-N complex - ATP-Mg-bound conformation - Form 2
6WG6 3.54 Å, Crystal structure of human SMC1-SMC3 hinge domain heterodimer in north-open conformation
8P0A 3.67 Å, Human Cohesin ATPase module
6WGE 3.9 Å, Cryo-EM structure of human Cohesin-NIPBL-DNA complex without STAG1
8PQ5 4.4 Å, Human Cohesin ATPase module with an open DNA exit gate
6WG3 5.3 Å, Cryo-EM structure of human Cohesin-NIPBL-DNA complex
7W1M 6.5 Å, Cryo-EM structure of human cohesin-CTCF-DNA complex

Browse structure collections

About this viewer

MolViewer shows 8ROI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.