Human cohesin SMC3-HD(EQ)/RAD21-N complex - ATP-Mg-bound conformation - Form 1. Determined by X-ray diffraction at 2.25 Å resolution. Released 11 Sept 2024.
Explore 8ROK in 3D Show helices and sheets RCSB PDB PDBe
8ROK contains 41 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-9 | 8 | 1 |
| β-strand | 11 | 1 | 2 |
| β-strand | 14 | 1 | 2 |
| β-strand | 18-19 | 2 | 1 |
| α-helix | 20-24 | 5 | |
| β-strand | 27-31 | 5 | 3 |
| α-helix | 38-49 | 12 | |
| α-helix | 51-53 | 3 | |
| α-helix | 58-64 | 7 | |
| β-strand | 65 | 1 | 2 |
| α-helix | 72-73 | 2 | |
| β-strand | 75-83 | 9 | 1 |
| β-strand | 95-103 | 9 | 1 |
| β-strand | 107-111 | 5 | 1 |
| β-strand | 114-116 | 3 | 1 |
| α-helix | 118-127 | 10 | |
| β-strand | 138-140 | 3 | 3 |
| α-helix | 141-148 | 8 | |
| α-helix | 152-163 | 12 | |
| α-helix | 165-190 | 26 | |
| α-helix | 191-194 | 4 | |
| α-helix | 995-1047 | 53 | |
| β-strand | 1052-1057 | 6 | 4 |
| β-strand | 1096-1101 | 6 | 4 |
| β-strand | 1110-1111 | 2 | 4 |
| α-helix | 1112-1114 | 3 | |
| α-helix | 1117-1132 | 16 | |
| β-strand | 1139-1143 | 5 | 3 |
| α-helix | 1151-1164 | 14 | |
| β-strand | 1169-1173 | 5 | 3 |
| α-helix | 1180-1182 | 3 | |
| β-strand | 1185-1192 | 8 | 3 |
| β-strand | 1195-1201 | 7 | 3 |
| α-helix | 1203-1210 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-22 | 10 | |
| α-helix | 24-26 | 3 | |
| α-helix | 29-34 | 6 | |
| α-helix | 37-45 | 9 | |
| α-helix | 53-79 | 27 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-9 | 8 | 5 |
| β-strand | 11 | 1 | 6 |
| β-strand | 14 | 1 | 6 |
| β-strand | 18-19 | 2 | 5 |
| α-helix | 22-24 | 3 | |
| β-strand | 27-31 | 5 | 7 |
| α-helix | 38-49 | 12 | |
| α-helix | 51-53 | 3 | |
| α-helix | 58-64 | 7 | |
| β-strand | 65 | 1 | 6 |
| α-helix | 72-73 | 2 | |
| β-strand | 75-83 | 9 | 5 |
| β-strand | 95-103 | 9 | 5 |
| β-strand | 107-111 | 5 | 5 |
| β-strand | 114-116 | 3 | 5 |
| α-helix | 118-127 | 10 | |
| β-strand | 138-140 | 3 | 7 |
| α-helix | 141-148 | 8 | |
| α-helix | 152-163 | 12 | |
| α-helix | 165-199 | 35 | |
| α-helix | 992-1023 | 32 | |
| α-helix | 1025-1047 | 23 | |
| β-strand | 1052-1057 | 6 | 8 |
| β-strand | 1096-1101 | 6 | 8 |
| β-strand | 1110-1111 | 2 | 8 |
| α-helix | 1112-1114 | 3 | |
| α-helix | 1117-1134 | 18 | |
| β-strand | 1139-1143 | 5 | 7 |
| α-helix | 1151-1164 | 14 | |
| β-strand | 1169-1173 | 5 | 7 |
| α-helix | 1179-1182 | 4 | |
| β-strand | 1185-1192 | 8 | 7 |
| β-strand | 1195-1201 | 7 | 7 |
| α-helix | 1203-1211 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-22 | 11 | |
| α-helix | 29-34 | 6 | |
| α-helix | 37-45 | 9 | |
| α-helix | 53-86 | 34 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Structural maintenance of chromosomes protein 3 | A, C | protein | 462 | Homo sapiens | Q9UQE7 (AlphaFold model) |
| Double-strand-break repair protein rad21 homolog | B, D | protein | 110 | Homo sapiens | O60216 (AlphaFold model) |
>8ROK_1 Structural maintenance of chromosomes protein 3 (chains A, C) MYIKQVIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSHLRPEQ RLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKEEVSLRRVIGAKKDQYFLDKKMVTKND VMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMK ETEGKREKINELLKYIEERLHTLEEEKEELAGSGSLVPRGSGSYSHVNKKALDQFVNFSE QKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATL VMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQL SGGQKSLVALALIFAIQKCDPAPFYLFDQIDQALDAQHRKAVSDMIMELAVHAQFITTTF RPELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTHG
>8ROK_2 Double-strand-break repair protein rad21 homolog (chains B, D) MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREGSLEVLFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
| AGS | Phosphothiophosphoric acid-adenylate ester | C10 H16 N5 O12 P3 S | 2 |
The cohesin ATPase cycle is mediated by specific conformational dynamics and interface plasticity of SMC1A and SMC3 ATPase domains. Vitoria Gomes, M., Landwerlin, P., Diebold-Durand, M.L. et al. Cell Rep (2024) 43:114656-114656. DOI 10.1016/j.celrep.2024.114656 · PubMed
Other PDB entries of the same protein (UniProt Q9UQE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8ROK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.