HIF prolyl hydroxylase 2 (PHD2) T387I variant bound to Fe(III), 2-oxoglutarate (2OG) and Hypoxia-inducible Factor 2alpha (HIF2alpha). Determined by X-ray diffraction at 1.66 Å resolution. Released 12 Feb 2025.
Explore 8RUV in 3D Show helices and sheets RCSB PDB PDBe
8RUV contains 12 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 190-192 | 3 | |
| α-helix | 193-198 | 6 | |
| α-helix | 199-205 | 7 | |
| β-strand | 207-210 | 4 | 1 |
| α-helix | 216-231 | 16 | |
| β-strand | 236-237 | 2 | 1 |
| β-strand | 240 | 1 | 2 |
| α-helix | 248-250 | 3 | |
| β-strand | 252 | 1 | 3 |
| β-strand | 255-259 | 5 | 1 |
| α-helix | 267-282 | 16 | |
| β-strand | 292-295 | 4 | 1 |
| α-helix | 296-297 | 2 | |
| β-strand | 298-304 | 7 | 1 |
| β-strand | 308-313 | 6 | 3 |
| β-strand | 322-329 | 8 | 1 |
| β-strand | 331 | 1 | 4 |
| α-helix | 336-339 | 4 | |
| β-strand | 340 | 1 | 3 |
| β-strand | 343-345 | 3 | 3 |
| β-strand | 354-356 | 3 | 3 |
| β-strand | 359 | 1 | 4 |
| β-strand | 362-367 | 6 | 1 |
| β-strand | 374-379 | 6 | 3 |
| β-strand | 382-392 | 11 | 1 |
| α-helix | 393-404 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 526-528 | 3 | |
| β-strand | 531 | 1 | 2 |
| α-helix | 532 | 1 | |
| α-helix | 539 | 1 | |
| β-strand | 540-541 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Egl nine homolog 1 | A | protein | 227 | Homo sapiens | Q9GZT9 (AlphaFold model) |
| Hypoxia-inducible Factor-2alpha | B | protein | 19 | Homo sapiens | Q99814 (AlphaFold model) |
>8RUV_1 Egl nine homolog 1 (chains A) PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF DRLLFFWSDRRNPHEVQPAYATRYAIIVWYFDADERARAKVKYLTGE
>8RUV_2 Hypoxia-inducible Factor-2alpha (chains B) LDLETLAPYIPMDGEDFQL
Investigating gatekeeper residues in Prolyl hydroxylase 2. Fiorini, G., Schofield, C.J. To be published.
Other PDB entries of the same protein (UniProt Q9GZT9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8RUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.