Crystal structure of the TMPRSS2 zymogen in complex with the nanobody A07. Determined by X-ray diffraction at 1.8 Å resolution. Released 26 Jun 2024.
Explore 8S0L in 3D Show helices and sheets RCSB PDB PDBe
8S0L contains 19 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 118-119 | 2 | 1 |
| β-strand | 126-127 | 2 | 1 |
| α-helix | 129-131 | 3 | |
| α-helix | 143-145 | 3 | |
| β-strand | 149-152 | 4 | 2 |
| β-strand | 157-162 | 6 | 2 |
| β-strand | 167-170 | 4 | 2 |
| β-strand | 171 | 1 | 3 |
| β-strand | 172 | 1 | 2 |
| α-helix | 178-187 | 10 | |
| β-strand | 196-200 | 5 | 2 |
| β-strand | 209-212 | 4 | 3 |
| α-helix | 221-224 | 4 | |
| β-strand | 225-228 | 4 | 3 |
| β-strand | 236-240 | 5 | 2 |
| β-strand | 260-261 | 2 | 4 |
| α-helix | 262-263 | 2 | |
| β-strand | 270-275 | 6 | 5 |
| β-strand | 278-285 | 8 | 5 |
| β-strand | 290-293 | 4 | 5 |
| α-helix | 295-298 | 4 | |
| α-helix | 305-307 | 3 | |
| β-strand | 309-312 | 4 | 5 |
| β-strand | 316 | 1 | 6 |
| α-helix | 317-319 | 3 | |
| β-strand | 326-333 | 8 | 5 |
| β-strand | 338 | 1 | 7 |
| β-strand | 343 | 1 | 7 |
| β-strand | 347-351 | 5 | 5 |
| α-helix | 354-357 | 4 | |
| α-helix | 363-364 | 2 | |
| β-strand | 365 | 1 | 4 |
| α-helix | 366-368 | 3 | |
| β-strand | 378-383 | 6 | 4 |
| α-helix | 391-394 | 4 | |
| β-strand | 396 | 1 | 6 |
| β-strand | 398-405 | 8 | 4 |
| α-helix | 407-410 | 4 | |
| β-strand | 424-428 | 5 | 4 |
| β-strand | 444-449 | 6 | 4 |
| β-strand | 452-461 | 10 | 4 |
| β-strand | 472-476 | 5 | 4 |
| α-helix | 477-490 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-9 | 5 | 8 |
| β-strand | 12-14 | 3 | 9 |
| β-strand | 20-27 | 8 | 8 |
| α-helix | 31-33 | 3 | |
| β-strand | 34-41 | 8 | 9 |
| β-strand | 48-53 | 6 | 9 |
| β-strand | 60-62 | 3 | 9 |
| β-strand | 70-75 | 6 | 8 |
| β-strand | 80-85 | 6 | 8 |
| α-helix | 90-92 | 3 | |
| β-strand | 94-102 | 9 | 9 |
| α-helix | 103 | 1 | |
| β-strand | 104 | 1 | 4 |
| α-helix | 109-111 | 3 | |
| α-helix | 112-116 | 5 | |
| β-strand | 119-120 | 2 | 9 |
| β-strand | 124-128 | 5 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transmembrane protease serine 2 | A | protein | 395 | Homo sapiens | O15393 (AlphaFold model) |
| Nanobody A07 | B | protein | 150 | Vicugna pacos |
>8S0L_1 Transmembrane protease serine 2 (chains A) KFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRK SWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLY HSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSII TPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDI ALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIE TQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDAGGPLVTSKNNIWWLIGDTSWGSGCA KAYRPGVYGNVMVFTDWIYRQMRADGGPFEDDDDK
>8S0L_2 Nanobody A07 (chains B) MGSSHHHHHHSSGGGQVQLVESGGGLVQPGGSLRLSCTSSGSPLEHYDIIWFRQAPGRER EGVSSITTSGGHTNYADSVKDRFTISRDNAKNVVYLQMNSLKPEDTAVYYCAGRVGGRRN WIVPLDGYDNAYWGQGTQVTVSSGGGSCSA
Structural basis of TMPRSS2 zymogen activation and recognition by the HKU1 seasonal coronavirus. Fernandez, I., Saunders, N., Duquerroy, S. et al. Cell (2024) 187:4246-4260.e16. DOI 10.1016/j.cell.2024.06.007 · PubMed
Other PDB entries of the same protein (UniProt O15393 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8S0L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.