c-KIT kinase domain in complex with sunitinib. Determined by X-ray diffraction at 1.5 Å resolution. Released 3 Sept 2025.
Explore 8S14 in 3D Show helices and sheets RCSB PDB PDBe
8S14 contains 20 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 558-559 | 2 | 1 |
| β-strand | 560-562 | 3 | 2 |
| β-strand | 568-570 | 3 | 2 |
| α-helix | 573-575 | 3 | |
| α-helix | 580-582 | 3 | |
| β-strand | 583 | 1 | 3 |
| α-helix | 586-588 | 3 | |
| β-strand | 589-597 | 9 | 3 |
| β-strand | 601-608 | 8 | 3 |
| β-strand | 618-625 | 8 | 3 |
| α-helix | 631-647 | 17 | |
| β-strand | 653 | 1 | 4 |
| β-strand | 656-660 | 5 | 3 |
| β-strand | 667-671 | 5 | 3 |
| β-strand | 676-677 | 2 | 4 |
| α-helix | 678-685 | 8 | |
| α-helix | 686-688 | 3 | |
| β-strand | 690 | 1 | 5 |
| β-strand | 765 | 1 | 5 |
| α-helix | 766-785 | 20 | |
| β-strand | 788-789 | 2 | 1 |
| α-helix | 795-797 | 3 | |
| β-strand | 798-801 | 4 | 4 |
| α-helix | 802-804 | 3 | |
| β-strand | 805-808 | 4 | 4 |
| α-helix | 812-814 | 3 | |
| β-strand | 824-826 | 3 | 6 |
| β-strand | 829-831 | 3 | 6 |
| α-helix | 833-835 | 3 | |
| α-helix | 838-843 | 6 | |
| α-helix | 848-863 | 16 | |
| α-helix | 867-868 | 2 | |
| α-helix | 877-884 | 8 | |
| α-helix | 889-892 | 4 | |
| α-helix | 897-906 | 10 | |
| α-helix | 911-913 | 3 | |
| α-helix | 915-916 | 2 | |
| α-helix | 917-930 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mast/stem cell growth factor receptor Kit | A | protein | 327 | Homo sapiens | P10721 (AlphaFold model) |
>8S14_1 Mast/stem cell growth factor receptor Kit (chains A) GSMPMYEVQWKVVEESNGNNYSYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEAT AQGLIKSDAAMTVAVKMLKPSAHSTEREALMSELKVLSYLGNHENIVNLLGACTHGGPTL VITEYCCYGDLLNFLRRKRDEFVPYKVAPEDLYKDFLTLEHLLSFSYQVAKGMAFLASKN CIHRDLAARNILLTHGNITKICDFGLARDIKNDSNYVDKGNARLPVKWMAPESIFNSVYT FESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMSSPEYAPAEMYDIMKTCW DADPDKRPTFKQIVQDIEKQISESTNH
| ID | Name | Formula | Copies |
|---|---|---|---|
| B49 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fluoro-2-oxo-1,2-dihydro-3H-indol-3-ylidene… | C22 H27 F N4 O2 | 1 |
Water and common crystallization additives (CL, EDO) are not listed.
c-KIT kinase domain in complex with sunitinib. Teuber, A., Niggenaber, J., Kleinboelting, S.B. et al. To be published.
Other PDB entries of the same protein (UniProt P10721 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8S14 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.